Revised Cambridge Reference Sequence (rCRS) of the Human Mitochondrial DNA

The rCRS has a new number in GenBank! It is now officially NC_012920.1 gi:251831106

Get the rCRS and other complete mtDNA sequences at GenBank here.

IMPORTANT: Do not use RefSeq NC_001807 as "the rCRS" as it is an African (Yoruban) sequence with over 40 variant nucleotides from the rCRS. On July 8, 2009 the sequence was removed from GenBank as a reference sequence but may be found, if needed, as AF347015, one of 53 African sequence deposited in Genbank by Ingman et al in 2001. Unfortunately, mistaken use of this Yoruban sequence as the rCRS is still seen occasionally in new publications today.

The rCRS sequence below is the Cambridge Reference Sequence Anderson et al 1981 as revised by Andrews et al 1999. It differs from the original CRS and other complete hmtdna GenBank sequences in that it has eighteen corrected or confirmed nucleotides as annotated below. See the summary table of the reanalysis by Andrews et al.

  • Seven nucleotides are considered to be rare polymorphisms and were determined to be correct as originally sequenced (J01415 gi: 337188). Nucleotides 263A, 311C-315C, 750A, 1438A, 4769A, 8860A, and 15326A are considered to be rare polymorphisms and are maintained as part of the true reference sequence. The seven rare polymorphisms are shown below in bold green letters.
  • Eleven nucleotide errors in the original CRS have been corrected by re-sequencing the original placental material. Nucleotides 3107del*, 3423T, 4985A, 9559C, 11335C, 13702C, 14199T, 14272C, 14365C, 14368C, 14766C are corrections of the original Cambridge sequence (J01415 gi: 337188). The errors in the original Cambridge sequence have been attributed to sequencing errors (8 instances) and to the inclusion of bovine (2 instances) or HeLa (1 instance) DNA. See summary table. Corrected sequencing errors are shown below in bold red letters. 3107del is maintained in this revised sequence with the gap represented by an 'N'. THIS ALLOWS HISTORICAL NUCLEOTIDE NUMBERING TO BE MAINTAINED.

  • For strand composition asymmetry and an explanation of L-strand/H-strand terminology, click here.
        10         20         30         40         50         60 
GATCACAGGT CTATCACCCT ATTAACCACT CACGGGAGCT CTCCATGCAT TTGGTATTTT 
CTAGTGTCCA GATAGTGGGA TAATTGGTGA GTGCCCTCGA GAGGTACGTA AACCATAAAA 
                                                                  
        70         80         90        100        110        120 
CGTCTGGGGG GTATGCACGC GATAGCATTG CGAGACGCTG GAGCCGGAGC ACCCTATGTC 
GCAGACCCCC CATACGTGCG CTATCGTAAC GCTCTGCGAC CTCGGCCTCG TGGGATACAG 
                                                                  
       130        140        150        160        170        180 
GCAGTATCTG TCTTTGATTC CTGCCTCATC CTATTATTTA TCGCACCTAC GTTCAATATT 
CGTCATAGAC AGAAACTAAG GACGGAGTAG GATAATAAAT AGCGTGGATG CAAGTTATAA 
                                                                  
       190        200        210        220        230        240 
ACAGGCGAAC ATACTTACTA AAGTGTGTTA ATTAATTAAT GCTTGTAGGA CATAATAATA 
TGTCCGCTTG TATGAATGAT TTCACACAAT TAATTAATTA CGAACATCCT GTATTATTAT 
                                                                  
       250        260        270        280        290        300 
ACAATTGAAT GTCTGCACAG CCACTTTCCA CACAGACATC ATAACAAAAA ATTTCCACCA
TGTTAACTTA CAGACGTGTC GGTGAAAGGT GTGTCTGTAG TATTGTTTTT TAAAGGTGGT 
                                                                  
       310        320        330        340        350        360 
AACCCCCCCT CCCCCGCTTC TGGCCACAGC ACTTAAACAC ATCTCTGCCA AACCCCAAAA 

Back to Top
TTGGGGGGGA GGGGGCGAAG ACCGGTGTCG TGAATTTGTG TAGAGACGGT TTGGGGTTTT 
                                                                  
       370        380        390        400        410        420 
ACAAAGAACC CTAACACCAG CCTAACCAGA TTTCAAATTT TATCTTTTGG CGGTATGCAC 
TGTTTCTTGG GATTGTGGTC GGATTGGTCT AAAGTTTAAA ATAGAAAACC GCCATACGTG 
                                                                  
       430        440        450        460        470        480 
TTTTAACAGT CACCCCCCAA CTAACACATT ATTTTCCCCT CCCACTCCCA TACTACTAAT 
AAAATTGTCA GTGGGGGGTT GATTGTGTAA TAAAAGGGGA GGGTGAGGGT ATGATGATTA 
                                                                  
       490        500        510        520        530        540 
CTCATCAATA CAACCCCCGC CCATCCTACC CAGCACACAC ACACCGCTGC TAACCCCATA 
GAGTAGTTAT GTTGGGGGCG GGTAGGATGG GTCGTGTGTG TGTGGCGACG ATTGGGGTAT 
                                                                  
       550        560        570        580        590        600 
CCCCGAACCA ACCAAACCCC AAAGACACCC CCCACAGTTT ATGTAGCTTA CCTCCTCAAA 
GGGGCTTGGT TGGTTTGGGG TTTCTGTGGG GGGTGTCAAA TACATCGAAT GGAGGAGTTT 
                                                                  
       610        620        630        640        650        660 
GCAATACACT GAAAATGTTT AGACGGGCTC ACATCACCCC ATAAACAAAT AGGTTTGGTC 
CGTTATGTGA CTTTTACAAA TCTGCCCGAG TGTAGTGGGG TATTTGTTTA TCCAAACCAG 
                                                                  
       670        680        690        700        710        720 
CTAGCCTTTC TATTAGCTCT TAGTAAGATT ACACATGCAA GCATCCCCGT TCCAGTGAGT 
GATCGGAAAG ATAATCGAGA ATCATTCTAA TGTGTACGTT CGTAGGGGCA AGGTCACTCA 
                                                                  
       730        740        750        760        770        780 
TCACCCTCTA AATCACCACG ATCAAAAGGA ACAAGCATCA AGCACGCAGC AATGCAGCTC  

Back to Top
AGTGGGAGAT TTAGTGGTGC TAGTTTTCCT TGTTCGTAGT TCGTGCGTCG TTACGTCGAG 
                                                                  
       790        800        810        820        830        840 
AAAACGCTTA GCCTAGCCAC ACCCCCACGG GAAACAGCAG TGATTAACCT TTAGCAATAA 
TTTTGCGAAT CGGATCGGTG TGGGGGTGCC CTTTGTCGTC ACTAATTGGA AATCGTTATT 
                                                                  
       850        860        870        880        890        900 
ACGAAAGTTT AACTAAGCTA TACTAACCCC AGGGTTGGTC AATTTCGTGC CAGCCACCGC 
TGCTTTCAAA TTGATTCGAT ATGATTGGGG TCCCAACCAG TTAAAGCACG GTCGGTGGCG 
                                                                  
       910        920        930        940        950        960 
GGTCACACGA TTAACCCAAG TCAATAGAAG CCGGCGTAAA GAGTGTTTTA GATCACCCCC 
CCAGTGTGCT AATTGGGTTC AGTTATCTTC GGCCGCATTT CTCACAAAAT CTAGTGGGGG 
                                                                  
       970        980        990       1000       1010       1020 
TCCCCAATAA AGCTAAAACT CACCTGAGTT GTAAAAAACT CCAGTTGACA CAAAATAGAC 
AGGGGTTATT TCGATTTTGA GTGGACTCAA CATTTTTTGA GGTCAACTGT GTTTTATCTG 
                                                                  
      1030       1040       1050       1060       1070       1080 
TACGAAAGTG GCTTTAACAT ATCTGAACAC ACAATAGCTA AGACCCAAAC TGGGATTAGA 
ATGCTTTCAC CGAAATTGTA TAGACTTGTG TGTTATCGAT TCTGGGTTTG ACCCTAATCT 
                                                                  
      1090       1100       1110       1120       1130       1140 
TACCCCACTA TGCTTAGCCC TAAACCTCAA CAGTTAAATC AACAAAACTG CTCGCCAGAA 
ATGGGGTGAT ACGAATCGGG ATTTGGAGTT GTCAATTTAG TTGTTTTGAC GAGCGGTCTT 
                                                                  
      1150       1160       1170       1180       1190       1200 
CACTACGAGC CACAGCTTAA AACTCAAAGG ACCTGGCGGT GCTTCATATC CCTCTAGAGG 
GTGATGCTCG GTGTCGAATT TTGAGTTTCC TGGACCGCCA CGAAGTATAG GGAGATCTCC 
                                                                  
      1210       1220       1230       1240       1250       1260 
AGCCTGTTCT GTAATCGATA AACCCCGATC AACCTCACCA CCTCTTGCTC AGCCTATATA 
TCGGACAAGA CATTAGCTAT TTGGGGCTAG TTGGAGTGGT GGAGAACGAG TCGGATATAT 
                                                                  
      1270       1280       1290       1300       1310       1320 
CCGCCATCTT CAGCAAACCC TGATGAAGGC TACAAAGTAA GCGCAAGTAC CCACGTAAAG 
GGCGGTAGAA GTCGTTTGGG ACTACTTCCG ATGTTTCATT CGCGTTCATG GGTGCATTTC 
                                                                  
      1330       1340       1350       1360       1370       1380 
ACGTTAGGTC AAGGTGTAGC CCATGAGGTG GCAAGAAATG GGCTACATTT TCTACCCCAG 
TGCAATCCAG TTCCACATCG GGTACTCCAC CGTTCTTTAC CCGATGTAAA AGATGGGGTC 
                                                                  
      1390       1400       1410       1420       1430       1440 
AAAACTACGA TAGCCCTTAT GAAACTTAAG GGTCGAAGGT GGATTTAGCA GTAAACTAAG   

Back to Top
TTTTGATGCT ATCGGGAATA CTTTGAATTC CCAGCTTCCA CCTAAATCGT CATTTGATTC 
                                                                  
      1450       1460       1470       1480       1490       1500 
AGTAGAGTGC TTAGTTGAAC AGGGCCCTGA AGCGCGTACA CACCGCCCGT CACCCTCCTC 
TCATCTCACG AATCAACTTG TCCCGGGACT TCGCGCATGT GTGGCGGGCA GTGGGAGGAG 
                                                                  
      1510       1520       1530       1540       1550       1560 
AAGTATACTT CAAAGGACAT TTAACTAAAA CCCCTACGCA TTTATATAGA GGAGACAAGT 
TTCATATGAA GTTTCCTGTA AATTGATTTT GGGGATGCGT AAATATATCT CCTCTGTTCA 
                                                                  
      1570       1580       1590       1600       1610       1620 
CGTAACATGG TAAGTGTACT GGAAAGTGCA CTTGGACGAA CCAGAGTGTA GCTTAACACA 
GCATTGTACC ATTCACATGA CCTTTCACGT GAACCTGCTT GGTCTCACAT CGAATTGTGT 
                                                                  
      1630       1640       1650       1660       1670       1680 
AAGCACCCAA CTTACACTTA GGAGATTTCA ACTTAACTTG ACCGCTCTGA GCTAAACCTA 
TTCGTGGGTT GAATGTGAAT CCTCTAAAGT TGAATTGAAC TGGCGAGACT CGATTTGGAT 
                                                                  
      1690       1700       1710       1720       1730       1740 
GCCCCAAACC CACTCCACCT TACTACCAGA CAACCTTAGC CAAACCATTT ACCCAAATAA 
CGGGGTTTGG GTGAGGTGGA ATGATGGTCT GTTGGAATCG GTTTGGTAAA TGGGTTTATT 
                                                                  
      1750       1760       1770       1780       1790       1800 
AGTATAGGCG ATAGAAATTG AAACCTGGCG CAATAGATAT AGTACCGCAA GGGAAAGATG 
TCATATCCGC TATCTTTAAC TTTGGACCGC GTTATCTATA TCATGGCGTT CCCTTTCTAC 
                                                                  
      1810       1820       1830       1840       1850       1860 
AAAAATTATA ACCAAGCATA ATATAGCAAG GACTAACCCC TATACCTTCT GCATAATGAA 
TTTTTAATAT TGGTTCGTAT TATATCGTTC CTGATTGGGG ATATGGAAGA CGTATTACTT 
                                                                  
      1870       1880       1890       1900       1910       1920 
TTAACTAGAA ATAACTTTGC AAGGAGAGCC AAAGCTAAGA CCCCCGAAAC CAGACGAGCT 
AATTGATCTT TATTGAAACG TTCCTCTCGG TTTCGATTCT GGGGGCTTTG GTCTGCTCGA 
                                                                  
      1930       1940       1950       1960       1970       1980 
ACCTAAGAAC AGCTAAAAGA GCACACCCGT CTATGTAGCA AAATAGTGGG AAGATTTATA 
TGGATTCTTG TCGATTTTCT CGTGTGGGCA GATACATCGT TTTATCACCC TTCTAAATAT 
                                                                  
      1990       2000       2010       2020       2030       2040 
GGTAGAGGCG ACAAACCTAC CGAGCCTGGT GATAGCTGGT TGTCCAAGAT AGAATCTTAG 
CCATCTCCGC TGTTTGGATG GCTCGGACCA CTATCGACCA ACAGGTTCTA TCTTAGAATC 
                                                                  
      2050       2060       2070       2080       2090       2100 
TTCAACTTTA AATTTGCCCA CAGAACCCTC TAAATCCCCT TGTAAATTTA ACTGTTAGTC 
AAGTTGAAAT TTAAACGGGT GTCTTGGGAG ATTTAGGGGA ACATTTAAAT TGACAATCAG 
                                                                  
      2110       2120       2130       2140       2150       2160 
CAAAGAGGAA CAGCTCTTTG GACACTAGGA AAAAACCTTG TAGAGAGAGT AAAAAATTTA 
GTTTCTCCTT GTCGAGAAAC CTGTGATCCT TTTTTGGAAC ATCTCTCTCA TTTTTTAAAT 
                                                                  
      2170       2180       2190       2200       2210       2220 
ACACCCATAG TAGGCCTAAA AGCAGCCACC AATTAAGAAA GCGTTCAAGC TCAACACCCA 
TGTGGGTATC ATCCGGATTT TCGTCGGTGG TTAATTCTTT CGCAAGTTCG AGTTGTGGGT 
                                                                  
      2230       2240       2250       2260       2270       2280 
CTACCTAAAA AATCCCAAAC ATATAACTGA ACTCCTCACA CCCAATTGGA CCAATCTATC 
GATGGATTTT TTAGGGTTTG TATATTGACT TGAGGAGTGT GGGTTAACCT GGTTAGATAG 
                                                                  
      2290       2300       2310       2320       2330       2340 
ACCCTATAGA AGAACTAATG TTAGTATAAG TAACATGAAA ACATTCTCCT CCGCATAAGC 
TGGGATATCT TCTTGATTAC AATCATATTC ATTGTACTTT TGTAAGAGGA GGCGTATTCG 
                                                                  
      2350       2360       2370       2380       2390       2400 
CTGCGTCAGA TTAAAACACT GAACTGACAA TTAACAGCCC AATATCTACA ATCAACCAAC 
GACGCAGTCT AATTTTGTGA CTTGACTGTT AATTGTCGGG TTATAGATGT TAGTTGGTTG 
                                                                  
      2410       2420       2430       2440       2450       2460 
AAGTCATTAT TACCCTCACT GTCAACCCAA CACAGGCATG CTCATAAGGA AAGGTTAAAA 
TTCAGTAATA ATGGGAGTGA CAGTTGGGTT GTGTCCGTAC GAGTATTCCT TTCCAATTTT 
                                                                  
      2470       2480       2490       2500       2510       2520 
AAAGTAAAAG GAACTCGGCA AATCTTACCC CGCCTGTTTA CCAAAAACAT CACCTCTAGC 
TTTCATTTTC CTTGAGCCGT TTAGAATGGG GCGGACAAAT GGTTTTTGTA GTGGAGATCG 
                                                                  
      2530       2540       2550       2560       2570       2580 
ATCACCAGTA TTAGAGGCAC CGCCTGCCCA GTGACACATG TTTAACGGCC GCGGTACCCT 
TAGTGGTCAT AATCTCCGTG GCGGACGGGT CACTGTGTAC AAATTGCCGG CGCCATGGGA 
                                                                  
      2590       2600       2610       2620       2630       2640 
AACCGTGCAA AGGTAGCATA ATCACTTGTT CCTTAAATAG GGACCTGTAT GAATGGCTCC 
TTGGCACGTT TCCATCGTAT TAGTGAACAA GGAATTTATC CCTGGACATA CTTACCGAGG 
                                                                  
      2650       2660       2670       2680       2690       2700 
ACGAGGGTTC AGCTGTCTCT TACTTTTAAC CAGTGAAATT GACCTGCCCG TGAAGAGGCG 
TGCTCCCAAG TCGACAGAGA ATGAAAATTG GTCACTTTAA CTGGACGGGC ACTTCTCCGC 
                                                                  
      2710       2720       2730       2740       2750       2760 
GGCATAACAC AGCAAGACGA GAAGACCCTA TGGAGCTTTA ATTTATTAAT GCAAACAGTA 
CCGTATTGTG TCGTTCTGCT CTTCTGGGAT ACCTCGAAAT TAAATAATTA CGTTTGTCAT 
                                                                  
      2770       2780       2790       2800       2810       2820 
CCTAACAAAC CCACAGGTCC TAAACTACCA AACCTGCATT AAAAATTTCG GTTGGGGCGA 
GGATTGTTTG GGTGTCCAGG ATTTGATGGT TTGGACGTAA TTTTTAAAGC CAACCCCGCT 
                                                                  
      2830       2840       2850       2860       2870       2880 
CCTCGGAGCA GAACCCAACC TCCGAGCAGT ACATGCTAAG ACTTCACCAG TCAAAGCGAA 
GGAGCCTCGT CTTGGGTTGG AGGCTCGTCA TGTACGATTC TGAAGTGGTC AGTTTCGCTT 
                                                                  
      2890       2900       2910       2920       2930       2940 
CTACTATACT CAATTGATCC AATAACTTGA CCAACGGAAC AAGTTACCCT AGGGATAACA 
GATGATATGA GTTAACTAGG TTATTGAACT GGTTGCCTTG TTCAATGGGA TCCCTATTGT 
                                                                  
      2950       2960       2970       2980       2990       3000 
GCGCAATCCT ATTCTAGAGT CCATATCAAC AATAGGGTTT ACGACCTCGA TGTTGGATCA 
CGCGTTAGGA TAAGATCTCA GGTATAGTTG TTATCCCAAA TGCTGGAGCT ACAACCTAGT 
                                                                  
      3010       3020       3030       3040       3050       3060 
GGACATCCCG ATGGTGCAGC CGCTATTAAA GGTTCGTTTG TTCAACGATT AAAGTCCTAC 
CCTGTAGGGC TACCACGTCG GCGATAATTT CCAAGCAAAC AAGTTGCTAA TTTCAGGATG 
                                                                  
      3070       3080       3090       3100      3110       3120 
GTGATCTGAG TTCAGACCGG AGTAATCCAG GTCGGTTTCT ATCTACnTTC AAATTCCTCC  

Back to Top
CACTAGACTC AAGTCTGGCC TCATTAGGTC CAGCCAAAGA TAGATGnAAG TTTAAGGAGG 
                                                                  
      3130       3140       3150       3160       3170       3180 
CTGTACGAAA GGACAAGAGA AATAAGGCCT ACTTCACAAA GCGCCTTCCC CCGTAAATGA 
GACATGCTTT CCTGTTCTCT TTATTCCGGA TGAAGTGTTT CGCGGAAGGG GGCATTTACT 
                                                                  
      3190       3200       3210       3220       3230       3240 
TATCATCTCA ACTTAGTATT ATACCCACAC CCACCCAAGA ACAGGGTTTG TTAAGATGGC 
ATAGTAGAGT TGAATCATAA TATGGGTGTG GGTGGGTTCT TGTCCCAAAC AATTCTACCG 
                                                                  
      3250       3260       3270       3280       3290       3300 
AGAGCCCGGT AATCGCATAA AACTTAAAAC TTTACAGTCA GAGGTTCAAT TCCTCTTCTT 
TCTCGGGCCA TTAGCGTATT TTGAATTTTG AAATGTCAGT CTCCAAGTTA AGGAGAAGAA 
                                                                  
      3310       3320       3330       3340       3350       3360 
AACAACATAC CCATGGCCAA CCTCCTACTC CTCATTGTAC CCATTCTAAT CGCAATGGCA 
TTGTTGTATG GGTACCGGTT GGAGGATGAG GAGTAACATG GGTAAGATTA GCGTTACCGT 
                                                                  
      3370       3380       3390       3400       3410       3420 
TTCCTAATGC TTACCGAACG AAAAATTCTA GGCTATATAC AACTACGCAA AGGCCCCAAC 
AAGGATTACG AATGGCTTGC TTTTTAAGAT CCGATATATG TTGATGCGTT TCCGGGGTTG 
                                                                  
      3430       3440       3450       3460       3470       3480 
GTTGTAGGCC CCTACGGGCT ACTACAACCC TTCGCTGACG CCATAAAACT CTTCACCAAA  

Back to Top CA A CATCCGG GGATGCCCGA TGATGTTGGG AAGCGACTGC GGTATTTTGA GAAGTGGTTT 3490 3500 3510 3520 3530 3540 GAGCCCCTAA AACCCGCCAC ATCTACCATC ACCCTCTACA TCACCGCCCC GACCTTAGCT CTCGGGGATT TTGGGCGGTG TAGATGGTAG TGGGAGATGT AGTGGCGGGG CTGGAATCGA 3550 3560 3570 3580 3590 3600 CTCACCATCG CTCTTCTACT ATGAACCCCC CTCCCCATAC CCAACCCCCT GGTCAACCTC GAGTGGTAGC GAGAAGATGA TACTTGGGGG GAGGGGTATG GGTTGGGGGA CCAGTTGGAG 3610 3620 3630 3640 3650 3660 AACCTAGGCC TCCTATTTAT TCTAGCCACC TCTAGCCTAG CCGTTTACTC AATCCTCTGA TTGGATCCGG AGGATAAATA AGATCGGTGG AGATCGGATC GGCAAATGAG TTAGGAGACT 3670 3680 3690 3700 3710 3720 TCAGGGTGAG CATCAAACTC AAACTACGCC CTGATCGGCG CACTGCGAGC AGTAGCCCAA AGTCCCACTC GTAGTTTGAG TTTGATGCGG GACTAGCCGC GTGACGCTCG TCATCGGGTT 3730 3740 3750 3760 3770 3780 ACAATCTCAT ATGAAGTCAC CCTAGCCATC ATTCTACTAT CAACATTACT AATAAGTGGC TGTTAGAGTA TACTTCAGTG GGATCGGTAG TAAGATGATA GTTGTAATGA TTATTCACCG 3790 3800 3810 3820 3830 3840 TCCTTTAACC TCTCCACCCT TATCACAACA CAAGAACACC TCTGATTACT CCTGCCATCA AGGAAATTGG AGAGGTGGGA ATAGTGTTGT GTTCTTGTGG AGACTAATGA GGACGGTAGT 3850 3860 3870 3880 3890 3900 TGACCCTTGG CCATAATATG ATTTATCTCC ACACTAGCAG AGACCAACCG AACCCCCTTC ACTGGGAACC GGTATTATAC TAAATAGAGG TGTGATCGTC TCTGGTTGGC TTGGGGGAAG 3910 3920 3930 3940 3950 3960 GACCTTGCCG AAGGGGAGTC CGAACTAGTC TCAGGCTTCA ACATCGAATA CGCCGCAGGC CTGGAACGGC TTCCCCTCAG GCTTGATCAG AGTCCGAAGT TGTAGCTTAT GCGGCGTCCG 3970 3980 3990 4000 4010 4020 CCCTTCGCCC TATTCTTCAT AGCCGAATAC ACAAACATTA TTATAATAAA CACCCTCACC GGGAAGCGGG ATAAGAAGTA TCGGCTTATG TGTTTGTAAT AATATTATTT GTGGGAGTGG 4030 4040 4050 4060 4070 4080 ACTACAATCT TCCTAGGAAC AACATATGAC GCACTCTCCC CTGAACTCTA CACAACATAT TGATGTTAGA AGGATCCTTG TTGTATACTG CGTGAGAGGG GACTTGAGAT GTGTTGTATA 4090 4100 4110 4120 4130 4140 TTTGTCACCA AGACCCTACT TCTAACCTCC CTGTTCTTAT GAATTCGAAC AGCATACCCC AAACAGTGGT TCTGGGATGA AGATTGGAGG GACAAGAATA CTTAAGCTTG TCGTATGGGG 4150 4160 4170 4180 4190 4200 CGATTCCGCT ACGACCAACT CATACACCTC CTATGAAAAA ACTTCCTACC ACTCACCCTA GCTAAGGCGA TGCTGGTTGA GTATGTGGAG GATACTTTTT TGAAGGATGG TGAGTGGGAT 4210 4220 4230 4240 4250 4260 GCATTACTTA TATGATATGT CTCCATACCC ATTACAATCT CCAGCATTCC CCCTCAAACC CGTAATGAAT ATACTATACA GAGGTATGGG TAATGTTAGA GGTCGTAAGG GGGAGTTTGG 4270 4280 4290 4300 4310 4320 TAAGAAATAT GTCTGATAAA AGAGTTACTT TGATAGAGTA AATAATAGGA GCTTAAACCC ATTCTTTATA CAGACTATTT TCTCAATGAA ACTATCTCAT TTATTATCCT CGAATTTGGG 4330 4340 4350 4360 4370 4380 CCTTATTTCT AGGACTATGA GAATCGAACC CATCCCTGAG AATCCAAAAT TCTCCGTGCC GGAATAAAGA TCCTGATACT CTTAGCTTGG GTAGGGACTC TTAGGTTTTA AGAGGCACGG 4390 4400 4410 4420 4430 4440 ACCTATCACA CCCCATCCTA AAGTAAGGTC AGCTAAATAA GCTATCGGGC CCATACCCCG TGGATAGTGT GGGGTAGGAT TTCATTCCAG TCGATTTATT CGATAGCCCG GGTATGGGGC 4450 4460 4470 4480 4490 4500 AAAATGTTGG TTATACCCTT CCCGTACTAA TTAATCCCCT GGCCCAACCC GTCATCTACT TTTTACAACC AATATGGGAA GGGCATGATT AATTAGGGGA CCGGGTTGGG CAGTAGATGA 4510 4520 4530 4540 4550 4560 CTACCATCTT TGCAGGCACA CTCATCACAG CGCTAAGCTC GCACTGATTT TTTACCTGAG GATGGTAGAA ACGTCCGTGT GAGTAGTGTC GCGATTCGAG CGTGACTAAA AAATGGACTC 4570 4580 4590 4600 4610 4620 TAGGCCTAGA AATAAACATG CTAGCTTTTA TTCCAGTTCT AACCAAAAAA ATAAACCCTC ATCCGGATCT TTATTTGTAC GATCGAAAAT AAGGTCAAGA TTGGTTTTTT TATTTGGGAG 4630 4640 4650 4660 4670 4680 GTTCCACAGA AGCTGCCATC AAGTATTTCC TCACGCAAGC AACCGCATCC ATAATCCTTC CAAGGTGTCT TCGACGGTAG TTCATAAAGG AGTGCGTTCG TTGGCGTAGG TATTAGGAAG 4690 4700 4710 4720 4730 4740 TAATAGCTAT CCTCTTCAAC AATATACTCT CCGGACAATG AACCATAACC AATACTACCA ATTATCGATA GGAGAAGTTG TTATATGAGA GGCCTGTTAC TTGGTATTGG TTATGATGGT 4750 4760 4770 4780 4790 4800 ATCAATACTC ATCATTAATA ATCATAAT A G CTATAGCAAT AAAACTAGGA ATAGCCCCCT Back to Top TAGTTATGAG TAGTAATTAT TAGTATTA T C GATATCGTTA TTTTGATCCT TATCGGGGGA 4810 4820 4830 4840 4850 4860 TTCACTTCTG AGTCCCAGAG GTTACCCAAG GCACCCCTCT GACATCCGGC CTGCTTCTTC AAGTGAAGAC TCAGGGTCTC CAATGGGTTC CGTGGGGAGA CTGTAGGCCG GACGAAGAAG 4870 4880 4890 4900 4910 4920 TCACATGACA AAAACTAGCC CCCATCTCAA TCATATACCA AATCTCTCCC TCACTAAACG AGTGTACTGT TTTTGATCGG GGGTAGAGTT AGTATATGGT TTAGAGAGGG AGTGATTTGC 4930 4940 4950 4960 4970 4980 TAAGCCTTCT CCTCACTCTC TCAATCTTAT CCATCATAGC AGGCAGTTGA GGTGGATTAA ATTCGGAAGA GGAGTGAGAG AGTTAGAATA GGTAGTATCG TCCGTCAACT CCACCTAATT 4990 5000 5010 5020 5030 5040 ACCA A ACCCA GCTACGCAAA ATCTTAGCAT ACTCCTCAAT TACCCACATA GGATGAATAA Back to Top TGGT T TGGGT CGATGCGTTT TAGAATCGTA TGAGGAGTTA ATGGGTGTAT CCTACTTATT 5050 5060 5070 5080 5090 5100 TAGCAGTTCT ACCGTACAAC CCTAACATAA CCATTCTTAA TTTAACTATT TATATTATCC ATCGTCAAGA TGGCATGTTG GGATTGTATT GGTAAGAATT AAATTGATAA ATATAATAGG 5110 5120 5130 5140 5150 5160 TAACTACTAC CGCATTCCTA CTACTCAACT TAAACTCCAG CACCACGACC CTACTACTAT ATTGATGATG GCGTAAGGAT GATGAGTTGA ATTTGAGGTC GTGGTGCTGG GATGATGATA 5170 5180 5190 5200 5210 5220 CTCGCACCTG AAACAAGCTA ACATGACTAA CACCCTTAAT TCCATCCACC CTCCTCTCCC GAGCGTGGAC TTTGTTCGAT TGTACTGATT GTGGGAATTA AGGTAGGTGG GAGGAGAGGG 5230 5240 5250 5260 5270 5280 TAGGAGGCCT GCCCCCGCTA ACCGGCTTTT TGCCCAAATG GGCCATTATC GAAGAATTCA ATCCTCCGGA CGGGGGCGAT TGGCCGAAAA ACGGGTTTAC CCGGTAATAG CTTCTTAAGT 5290 5300 5310 5320 5330 5340 CAAAAAACAA TAGCCTCATC ATCCCCACCA TCATAGCCAC CATCACCCTC CTTAACCTCT GTTTTTTGTT ATCGGAGTAG TAGGGGTGGT AGTATCGGTG GTAGTGGGAG GAATTGGAGA 5350 5360 5370 5380 5390 5400 ACTTCTACCT ACGCCTAATC TACTCCACCT CAATCACACT ACTCCCCATA TCTAACAACG TGAAGATGGA TGCGGATTAG ATGAGGTGGA GTTAGTGTGA TGAGGGGTAT AGATTGTTGC 5410 5420 5430 5440 5450 5460 TAAAAATAAA ATGACAGTTT GAACATACAA AACCCACCCC ATTCCTCCCC ACACTCATCG ATTTTTATTT TACTGTCAAA CTTGTATGTT TTGGGTGGGG TAAGGAGGGG TGTGAGTAGC 5470 5480 5490 5500 5510 5520 CCCTTACCAC GCTACTCCTA CCTATCTCCC CTTTTATACT AATAATCTTA TAGAAATTTA GGGAATGGTG CGATGAGGAT GGATAGAGGG GAAAATATGA TTATTAGAAT ATCTTTAAAT 5530 5540 5550 5560 5570 5580 GGTTAAATAC AGACCAAGAG CCTTCAAAGC CCTCAGTAAG TTGCAATACT TAATTTCTGT CCAATTTATG TCTGGTTCTC GGAAGTTTCG GGAGTCATTC AACGTTATGA ATTAAAGACA 5590 5600 5610 5620 5630 5640 AACAGCTAAG GACTGCAAAA CCCCACTCTG CATCAACTGA ACGCAAATCA GCCACTTTAA TTGTCGATTC CTGACGTTTT GGGGTGAGAC GTAGTTGACT TGCGTTTAGT CGGTGAAATT 5650 5660 5670 5680 5690 5700 TTAAGCTAAG CCCTTACTAG ACCAATGGGA CTTAAACCCA CAAACACTTA GTTAACAGCT AATTCGATTC GGGAATGATC TGGTTACCCT GAATTTGGGT GTTTGTGAAT CAATTGTCGA 5710 5720 5730 5740 5750 5760 AAGCACCCTA ATCAACTGGC TTCAATCTAC TTCTCCCGCC GCCGGGAAAA AAGGCGGGAG TTCGTGGGAT TAGTTGACCG AAGTTAGATG AAGAGGGCGG CGGCCCTTTT TTCCGCCCTC 5770 5780 5790 5800 5810 5820 AAGCCCCGGC AGGTTTGAAG CTGCTTCTTC GAATTTGCAA TTCAATATGA AAATCACCTC TTCGGGGCCG TCCAAACTTC GACGAAGAAG CTTAAACGTT AAGTTATACT TTTAGTGGAG 5830 5840 5850 5860 5870 5880 GGAGCTGGTA AAAAGAGGCC TAACCCCTGT CTTTAGATTT ACAGTCCAAT GCTTCACTCA CCTCGACCAT TTTTCTCCGG ATTGGGGACA GAAATCTAAA TGTCAGGTTA CGAAGTGAGT 5890 5900 5910 5920 5930 5940 GCCATTTTAC CTCACCCCCA CTGATGTTCG CCGACCGTTG ACTATTCTCT ACAAACCACA CGGTAAAATG GAGTGGGGGT GACTACAAGC GGCTGGCAAC TGATAAGAGA TGTTTGGTGT 5950 5960 5970 5980 5990 6000 AAGACATTGG AACACTATAC CTATTATTCG GCGCATGAGC TGGAGTCCTA GGCACAGCTC TTCTGTAACC TTGTGATATG GATAATAAGC CGCGTACTCG ACCTCAGGAT CCGTGTCGAG 6010 6020 6030 6040 6050 6060 TAAGCCTCCT TATTCGAGCC GAGCTGGGCC AGCCAGGCAA CCTTCTAGGT AACGACCACA ATTCGGAGGA ATAAGCTCGG CTCGACCCGG TCGGTCCGTT GGAAGATCCA TTGCTGGTGT 6070 6080 6090 6100 6110 6120 TCTACAACGT TATCGTCACA GCCCATGCAT TTGTAATAAT CTTCTTCATA GTAATACCCA AGATGTTGCA ATAGCAGTGT CGGGTACGTA AACATTATTA GAAGAAGTAT CATTATGGGT 6130 6140 6150 6160 6170 6180 TCATAATCGG AGGCTTTGGC AACTGACTAG TTCCCCTAAT AATCGGTGCC CCCGATATGG AGTATTAGCC TCCGAAACCG TTGACTGATC AAGGGGATTA TTAGCCACGG GGGCTATACC 6190 6200 6210 6220 6230 6240 CGTTTCCCCG CATAAACAAC ATAAGCTTCT GACTCTTACC TCCCTCTCTC CTACTCCTGC GCAAAGGGGC GTATTTGTTG TATTCGAAGA CTGAGAATGG AGGGAGAGAG GATGAGGACG 6250 6260 6270 6280 6290 6300 TCGCATCTGC TATAGTGGAG GCCGGAGCAG GAACAGGTTG AACAGTCTAC CCTCCCTTAG AGCGTAGACG ATATCACCTC CGGCCTCGTC CTTGTCCAAC TTGTCAGATG GGAGGGAATC 6310 6320 6330 6340 6350 6360 CAGGGAACTA CTCCCACCCT GGAGCCTCCG TAGACCTAAC CATCTTCTCC TTACACCTAG GTCCCTTGAT GAGGGTGGGA CCTCGGAGGC ATCTGGATTG GTAGAAGAGG AATGTGGATC 6370 6380 6390 6400 6410 6420 CAGGTGTCTC CTCTATCTTA GGGGCCATCA ATTTCATCAC AACAATTATC AATATAAAAC GTCCACAGAG GAGATAGAAT CCCCGGTAGT TAAAGTAGTG TTGTTAATAG TTATATTTTG 6430 6440 6450 6460 6470 6480 CCCCTGCCAT AACCCAATAC CAAACGCCCC TCTTCGTCTG ATCCGTCCTA ATCACAGCAG GGGGACGGTA TTGGGTTATG GTTTGCGGGG AGAAGCAGAC TAGGCAGGAT TAGTGTCGTC 6490 6500 6510 6520 6530 6540 TCCTACTTCT CCTATCTCTC CCAGTCCTAG CTGCTGGCAT CACTATACTA CTAACAGACC AGGATGAAGA GGATAGAGAG GGTCAGGATC GACGACCGTA GTGATATGAT GATTGTCTGG 6550 6560 6570 6580 6590 6600 GCAACCTCAA CACCACCTTC TTCGACCCCG CCGGAGGAGG AGACCCCATT CTATACCAAC CGTTGGAGTT GTGGTGGAAG AAGCTGGGGC GGCCTCCTCC TCTGGGGTAA GATATGGTTG 6610 6620 6630 6640 6650 6660 ACCTATTCTG ATTTTTCGGT CACCCTGAAG TTTATATTCT TATCCTACCA GGCTTCGGAA TGGATAAGAC TAAAAAGCCA GTGGGACTTC AAATATAAGA ATAGGATGGT CCGAAGCCTT 6670 6680 6690 6700 6710 6720 TAATCTCCCA TATTGTAACT TACTACTCCG GAAAAAAAGA ACCATTTGGA TACATAGGTA ATTAGAGGGT ATAACATTGA ATGATGAGGC CTTTTTTTCT TGGTAAACCT ATGTATCCAT 6730 6740 6750 6760 6770 6780 TGGTCTGAGC TATGATATCA ATTGGCTTCC TAGGGTTTAT CGTGTGAGCA CACCATATAT ACCAGACTCG ATACTATAGT TAACCGAAGG ATCCCAAATA GCACACTCGT GTGGTATATA 6790 6800 6810 6820 6830 6840 TTACAGTAGG AATAGACGTA GACACACGAG CATATTTCAC CTCCGCTACC ATAATCATCG AATGTCATCC TTATCTGCAT CTGTGTGCTC GTATAAAGTG GAGGCGATGG TATTAGTAGC 6850 6860 6870 6880 6890 6900 CTATCCCCAC CGGCGTCAAA GTATTTAGCT GACTCGCCAC ACTCCACGGA AGCAATATGA GATAGGGGTG GCCGCAGTTT CATAAATCGA CTGAGCGGTG TGAGGTGCCT TCGTTATACT 6910 6920 6930 6940 6950 6960 AATGATCTGC TGCAGTGCTC TGAGCCCTAG GATTCATCTT TCTTTTCACC GTAGGTGGCC TTACTAGACG ACGTCACGAG ACTCGGGATC CTAAGTAGAA AGAAAAGTGG CATCCACCGG 6970 6980 6990 7000 7010 7020 TGACTGGCAT TGTATTAGCA AACTCATCAC TAGACATCGT ACTACACGAC ACGTACTACG ACTGACCGTA ACATAATCGT TTGAGTAGTG ATCTGTAGCA TGATGTGCTG TGCATGATGC 7030 7040 7050 7060 7070 7080 TTGTAGCCCA CTTCCACTAT GTCCTATCAA TAGGAGCTGT ATTTGCCATC ATAGGAGGCT AACATCGGGT GAAGGTGATA CAGGATAGTT ATCCTCGACA TAAACGGTAG TATCCTCCGA 7090 7100 7110 7120 7130 7140 TCATTCACTG ATTTCCCCTA TTCTCAGGCT ACACCCTAGA CCAAACCTAC GCCAAAATCC AGTAAGTGAC TAAAGGGGAT AAGAGTCCGA TGTGGGATCT GGTTTGGATG CGGTTTTAGG 7150 7160 7170 7180 7190 7200 ATTTCACTAT CATATTCATC GGCGTAAATC TAACTTTCTT CCCACAACAC TTTCTCGGCC TAAAGTGATA GTATAAGTAG CCGCATTTAG ATTGAAAGAA GGGTGTTGTG AAAGAGCCGG 7210 7220 7230 7240 7250 7260 TATCCGGAAT GCCCCGACGT TACTCGGACT ACCCCGATGC ATACACCACA TGAAACATCC ATAGGCCTTA CGGGGCTGCA ATGAGCCTGA TGGGGCTACG TATGTGGTGT ACTTTGTAGG 7270 7280 7290 7300 7310 7320 TATCATCTGT AGGCTCATTC ATTTCTCTAA CAGCAGTAAT ATTAATAATT TTCATGATTT ATAGTAGACA TCCGAGTAAG TAAAGAGATT GTCGTCATTA TAATTATTAA AAGTACTAAA 7330 7340 7350 7360 7370 7380 GAGAAGCCTT CGCTTCGAAG CGAAAAGTCC TAATAGTAGA AGAACCCTCC ATAAACCTGG CTCTTCGGAA GCGAAGCTTC GCTTTTCAGG ATTATCATCT TCTTGGGAGG TATTTGGACC 7390 7400 7410 7420 7430 7440 AGTGACTATA TGGATGCCCC CCACCCTACC ACACATTCGA AGAACCCGTA TACATAAAAT TCACTGATAT ACCTACGGGG GGTGGGATGG TGTGTAAGCT TCTTGGGCAT ATGTATTTTA 7450 7460 7470 7480 7490 7500 CTAGACAAAA AAGGAAGGAA TCGAACCCCC CAAAGCTGGT TTCAAGCCAA CCCCATGGCC GATCTGTTTT TTCCTTCCTT AGCTTGGGGG GTTTCGACCA AAGTTCGGTT GGGGTACCGG 7510 7520 7530 7540 7550 7560 TCCATGACTT TTTCAAAAAG GTATTAGAAA AACCATTTCA TAACTTTGTC AAAGTTAAAT AGGTACTGAA AAAGTTTTTC CATAATCTTT TTGGTAAAGT ATTGAAACAG TTTCAATTTA 7570 7580 7590 7600 7610 7620 TATAGGCTAA ATCCTATATA TCTTAATGGC ACATGCAGCG CAAGTAGGTC TACAAGACGC ATATCCGATT TAGGATATAT AGAATTACCG TGTACGTCGC GTTCATCCAG ATGTTCTGCG 7630 7640 7650 7660 7670 7680 TACTTCCCCT ATCATAGAAG AGCTTATCAC CTTTCATGAT CACGCCCTCA TAATCATTTT ATGAAGGGGA TAGTATCTTC TCGAATAGTG GAAAGTACTA GTGCGGGAGT ATTAGTAAAA 7690 7700 7710 7720 7730 7740 CCTTATCTGC TTCCTAGTCC TGTATGCCCT TTTCCTAACA CTCACAACAA AACTAACTAA GGAATAGACG AAGGATCAGG ACATACGGGA AAAGGATTGT GAGTGTTGTT TTGATTGATT 7750 7760 7770 7780 7790 7800 TACTAACATC TCAGACGCTC AGGAAATAGA AACCGTCTGA ACTATCCTGC CCGCCATCAT ATGATTGTAG AGTCTGCGAG TCCTTTATCT TTGGCAGACT TGATAGGACG GGCGGTAGTA 7810 7820 7830 7840 7850 7860 CCTAGTCCTC ATCGCCCTCC CATCCCTACG CATCCTTTAC ATAACAGACG AGGTCAACGA GGATCAGGAG TAGCGGGAGG GTAGGGATGC GTAGGAAATG TATTGTCTGC TCCAGTTGCT 7870 7880 7890 7900 7910 7920 TCCCTCCCTT ACCATCAAAT CAATTGGCCA CCAATGGTAC TGAACCTACG AGTACACCGA AGGGAGGGAA TGGTAGTTTA GTTAACCGGT GGTTACCATG ACTTGGATGC TCATGTGGCT 7930 7940 7950 7960 7970 7980 CTACGGCGGA CTAATCTTCA ACTCCTACAT ACTTCCCCCA TTATTCCTAG AACCAGGCGA GATGCCGCCT GATTAGAAGT TGAGGATGTA TGAAGGGGGT AATAAGGATC TTGGTCCGCT 7990 8000 8010 8020 8030 8040 CCTGCGACTC CTTGACGTTG ACAATCGAGT AGTACTCCCG ATTGAAGCCC CCATTCGTAT GGACGCTGAG GAACTGCAAC TGTTAGCTCA TCATGAGGGC TAACTTCGGG GGTAAGCATA 8050 8060 8070 8080 8090 8100 AATAATTACA TCACAAGACG TCTTGCACTC ATGAGCTGTC CCCACATTAG GCTTAAAAAC TTATTAATGT AGTGTTCTGC AGAACGTGAG TACTCGACAG GGGTGTAATC CGAATTTTTG 8110 8120 8130 8140 8150 8160 AGATGCAATT CCCGGACGTC TAAACCAAAC CACTTTCACC GCTACACGAC CGGGGGTATA TCTACGTTAA GGGCCTGCAG ATTTGGTTTG GTGAAAGTGG CGATGTGCTG GCCCCCATAT 8170 8180 8190 8200 8210 8220 CTACGGTCAA TGCTCTGAAA TCTGTGGAGC AAACCACAGT TTCATGCCCA TCGTCCTAGA GATGCCAGTT ACGAGACTTT AGACACCTCG TTTGGTGTCA AAGTACGGGT AGCAGGATCT 8230 8240 8250 8260 8270 8280 ATTAATTCCC CTAAAAATCT TTGAAATAGG GCCCGTATTT ACCCTATAGC ACCCCCTCTA TAATTAAGGG GATTTTTAGA AACTTTATCC CGGGCATAAA TGGGATATCG TGGGGGAGAT 8290 8300 8310 8320 8330 8340 CCCCCTCTAG AGCCCACTGT AAAGCTAACT TAGCATTAAC CTTTTAAGTT AAAGATTAAG GGGGGAGATC TCGGGTGACA TTTCGATTGA ATCGTAATTG GAAAATTCAA TTTCTAATTC 8350 8360 8370 8380 8390 8400 AGAACCAACA CCTCTTTACA GTGAAATGCC CCAACTAAAT ACTACCGTAT GGCCCACCAT TCTTGGTTGT GGAGAAATGT CACTTTACGG GGTTGATTTA TGATGGCATA CCGGGTGGTA 8410 8420 8430 8440 8450 8460 AATTACCCCC ATACTCCTTA CACTATTCCT CATCACCCAA CTAAAAATAT TAAACACAAA TTAATGGGGG TATGAGGAAT GTGATAAGGA GTAGTGGGTT GATTTTTATA ATTTGTGTTT 8470 8480 8490 8500 8510 8520 CTACCACCTA CCTCCCTCAC CAAAGCCCAT AAAAATAAAA AATTATAACA AACCCTGAGA GATGGTGGAT GGAGGGAGTG GTTTCGGGTA TTTTTATTTT TTAATATTGT TTGGGACTCT 8530 8540 8550 8560 8570 8580 ACCAAAATGA ACGAAAATCT GTTCGCTTCA TTCATTGCCC CCACAATCCT AGGCCTACCC TGGTTTTACT TGCTTTTAGA CAAGCGAAGT AAGTAACGGG GGTGTTAGGA TCCGGATGGG 8590 8600 8610 8620 8630 8640 GCCGCAGTAC TGATCATTCT ATTTCCCCCT CTATTGATCC CCACCTCCAA ATATCTCATC CGGCGTCATG ACTAGTAAGA TAAAGGGGGA GATAACTAGG GGTGGAGGTT TATAGAGTAG 8650 8660 8670 8680 8690 8700 AACAACCGAC TAATCACCAC CCAACAATGA CTAATCAAAC TAACCTCAAA ACAAATGATA TTGTTGGCTG ATTAGTGGTG GGTTGTTACT GATTAGTTTG ATTGGAGTTT TGTTTACTAT 8710 8720 8730 8740 8750 8760 ACCATACACA ACACTAAAGG ACGAACCTGA TCTCTTATAC TAGTATCCTT AATCATTTTT TGGTATGTGT TGTGATTTCC TGCTTGGACT AGAGAATATG ATCATAGGAA TTAGTAAAAA 8770 8780 8790 8800 8810 8820 ATTGCCACAA CTAACCTCCT CGGACTCCTG CCTCACTCAT TTACACCAAC CACCCAACTA TAACGGTGTT GATTGGAGGA GCCTGAGGAC GGAGTGAGTA AATGTGGTTG GTGGGTTGAT 8830 8840 8850 8860 8870 8880 TCTATAAACC TAGCCATGGC CATCCCCTTA TGAGCGGGC A CAGTGATTAT AGGCTTTCGC Back to Top AGATATTTGG ATCGGTACCG GTAGGGGAAT ACTCGCCCG T GTCACTAATA TCCGAAAGCG 8890 8900 8910 8920 8930 8940 TCTAAGATTA AAAATGCCCT AGCCCACTTC TTACCACAAG GCACACCTAC ACCCCTTATC AGATTCTAAT TTTTACGGGA TCGGGTGAAG AATGGTGTTC CGTGTGGATG TGGGGAATAG 8950 8960 8970 8980 8990 9000 CCCATACTAG TTATTATCGA AACCATCAGC CTACTCATTC AACCAATAGC CCTGGCCGTA GGGTATGATC AATAATAGCT TTGGTAGTCG GATGAGTAAG TTGGTTATCG GGACCGGCAT 9010 9020 9030 9040 9050 9060 CGCCTAACCG CTAACATTAC TGCAGGCCAC CTACTCATGC ACCTAATTGG AAGCGCCACC GCGGATTGGC GATTGTAATG ACGTCCGGTG GATGAGTACG TGGATTAACC TTCGCGGTGG 9070 9080 9090 9100 9110 9120 CTAGCAATAT CAACCATTAA CCTTCCCTCT ACACTTATCA TCTTCACAAT TCTAATTCTA GATCGTTATA GTTGGTAATT GGAAGGGAGA TGTGAATAGT AGAAGTGTTA AGATTAAGAT 9130 9140 9150 9160 9170 9180 CTGACTATCC TAGAAATCGC TGTCGCCTTA ATCCAAGCCT ACGTTTTCAC ACTTCTAGTA GACTGATAGG ATCTTTAGCG ACAGCGGAAT TAGGTTCGGA TGCAAAAGTG TGAAGATCAT 9190 9200 9210 9220 9230 9240 AGCCTCTACC TGCACGACAA CACATAATGA CCCACCAATC ACATGCCTAT CATATAGTAA TCGGAGATGG ACGTGCTGTT GTGTATTACT GGGTGGTTAG TGTACGGATA GTATATCATT 9250 9260 9270 9280 9290 9300 AACCCAGCCC ATGACCCCTA ACAGGGGCCC TCTCAGCCCT CCTAATGACC TCCGGCCTAG TTGGGTCGGG TACTGGGGAT TGTCCCCGGG AGAGTCGGGA GGATTACTGG AGGCCGGATC 9310 9320 9330 9340 9350 9360 CCATGTGATT TCACTTCCAC TCCATAACGC TCCTCATACT AGGCCTACTA ACCAACACAC GGTACACTAA AGTGAAGGTG AGGTATTGCG AGGAGTATGA TCCGGATGAT TGGTTGTGTG 9370 9380 9390 9400 9410 9420 TAACCATATA CCAATGATGG CGCGATGTAA CACGAGAAAG CACATACCAA GGCCACCACA ATTGGTATAT GGTTACTACC GCGCTACATT GTGCTCTTTC GTGTATGGTT CCGGTGGTGT 9430 9440 9450 9460 9470 9480 CACCACCTGT CCAAAAAGGC CTTCGATACG GGATAATCCT ATTTATTACC TCAGAAGTTT GTGGTGGACA GGTTTTTCCG GAAGCTATGC CCTATTAGGA TAAATAATGG AGTCTTCAAA 9490 9500 9510 9520 9530 9540 TTTTCTTCGC AGGATTTTTC TGAGCCTTTT ACCACTCCAG CCTAGCCCCT ACCCCCCAAT AAAAGAAGCG TCCTAAAAAG ACTCGGAAAA TGGTGAGGTC GGATCGGGGA TGGGGGGTTA 9550 9560 9570 9580 9590 9600 TAGGAGGGCA CTGGCCCC C A ACAGGCATCA CCCCGCTAAA TCCCCTAGAA GTCCCACTCC Back to Top ATCCTCCCGT GACCGGGG G T TGTCCGTAGT GGGGCGATTT AGGGGATCTT CAGGGTGAGG 9610 9620 9630 9640 9650 9660 TAAACACATC CGTATTACTC GCATCAGGAG TATCAATCAC CTGAGCTCAC CATAGTCTAA ATTTGTGTAG GCATAATGAG CGTAGTCCTC ATAGTTAGTG GACTCGAGTG GTATCAGATT 9670 9680 9690 9700 9710 9720 TAGAAAACAA CCGAAACCAA ATAATTCAAG CACTGCTTAT TACAATTTTA CTGGGTCTCT ATCTTTTGTT GGCTTTGGTT TATTAAGTTC GTGACGAATA ATGTTAAAAT GACCCAGAGA 9730 9740 9750 9760 9770 9780 ATTTTACCCT CCTACAAGCC TCAGAGTACT TCGAGTCTCC CTTCACCATT TCCGACGGCA TAAAATGGGA GGATGTTCGG AGTCTCATGA AGCTCAGAGG GAAGTGGTAA AGGCTGCCGT 9790 9800 9810 9820 9830 9840 TCTACGGCTC AACATTTTTT GTAGCCACAG GCTTCCACGG ACTTCACGTC ATTATTGGCT AGATGCCGAG TTGTAAAAAA CATCGGTGTC CGAAGGTGCC TGAAGTGCAG TAATAACCGA 9850 9860 9870 9880 9890 9900 CAACTTTCCT CACTATCTGC TTCATCCGCC AACTAATATT TCACTTTACA TCCAAACATC GTTGAAAGGA GTGATAGACG AAGTAGGCGG TTGATTATAA AGTGAAATGT AGGTTTGTAG 9910 9920 9930 9940 9950 9960 ACTTTGGCTT CGAAGCCGCC GCCTGATACT GGCATTTTGT AGATGTGGTT TGACTATTTC TGAAACCGAA GCTTCGGCGG CGGACTATGA CCGTAAAACA TCTACACCAA ACTGATAAAG 9970 9980 9990 10000 10010 10020 TGTATGTCTC CATCTATTGA TGAGGGTCTT ACTCTTTTAG TATAAATAGT ACCGTTAACT ACATACAGAG GTAGATAACT ACTCCCAGAA TGAGAAAATC ATATTTATCA TGGCAATTGA 10030 10040 10050 10060 10070 10080 TCCAATTAAC TAGTTTTGAC AACATTCAAA AAAGAGTAAT AAACTTCGCC TTAATTTTAA AGGTTAATTG ATCAAAACTG TTGTAAGTTT TTTCTCATTA TTTGAAGCGG AATTAAAATT 10090 10100 10110 10120 10130 10140 TAATCAACAC CCTCCTAGCC TTACTACTAA TAATTATTAC ATTTTGACTA CCACAACTCA ATTAGTTGTG GGAGGATCGG AATGATGATT ATTAATAATG TAAAACTGAT GGTGTTGAGT 10150 10160 10170 10180 10190 10200 ACGGCTACAT AGAAAAATCC ACCCCTTACG AGTGCGGCTT CGACCCTATA TCCCCCGCCC TGCCGATGTA TCTTTTTAGG TGGGGAATGC TCACGCCGAA GCTGGGATAT AGGGGGCGGG 10210 10220 10230 10240 10250 10260 GCGTCCCTTT CTCCATAAAA TTCTTCTTAG TAGCTATTAC CTTCTTATTA TTTGATCTAG CGCAGGGAAA GAGGTATTTT AAGAAGAATC ATCGATAATG GAAGAATAAT AAACTAGATC 10270 10280 10290 10300 10310 10320 AAATTGCCCT CCTTTTACCC CTACCATGAG CCCTACAAAC AACTAACCTG CCACTAATAG TTTAACGGGA GGAAAATGGG GATGGTACTC GGGATGTTTG TTGATTGGAC GGTGATTATC 10330 10340 10350 10360 10370 10380 TTATGTCATC CCTCTTATTA ATCATCATCC TAGCCCTAAG TCTGGCCTAT GAGTGACTAC AATACAGTAG GGAGAATAAT TAGTAGTAGG ATCGGGATTC AGACCGGATA CTCACTGATG 10390 10400 10410 10420 10430 10440 AAAAAGGATT AGACTGAACC GAATTGGTAT ATAGTTTAAA CAAAACGAAT GATTTCGACT TTTTTCCTAA TCTGACTTGG CTTAACCATA TATCAAATTT GTTTTGCTTA CTAAAGCTGA 10450 10460 10470 10480 10490 10500 CATTAAATTA TGATAATCAT ATTTACCAAA TGCCCCTCAT TTACATAAAT ATTATACTAG GTAATTTAAT ACTATTAGTA TAAATGGTTT ACGGGGAGTA AATGTATTTA TAATATGATC 10510 10520 10530 10540 10550 10560 CATTTACCAT CTCACTTCTA GGAATACTAG TATATCGCTC ACACCTCATA TCCTCCCTAC GTAAATGGTA GAGTGAAGAT CCTTATGATC ATATAGCGAG TGTGGAGTAT AGGAGGGATG 10570 10580 10590 10600 10610 10620 TATGCCTAGA AGGAATAATA CTATCGCTGT TCATTATAGC TACTCTCATA ACCCTCAACA ATACGGATCT TCCTTATTAT GATAGCGACA AGTAATATCG ATGAGAGTAT TGGGAGTTGT 10630 10640 10650 10660 10670 10680 CCCACTCCCT CTTAGCCAAT ATTGTGCCTA TTGCCATACT AGTCTTTGCC GCCTGCGAAG GGGTGAGGGA GAATCGGTTA TAACACGGAT AACGGTATGA TCAGAAACGG CGGACGCTTC 10690 10700 10710 10720 10730 10740 CAGCGGTGGG CCTAGCCCTA CTAGTCTCAA TCTCCAACAC ATATGGCCTA GACTACGTAC GTCGCCACCC GGATCGGGAT GATCAGAGTT AGAGGTTGTG TATACCGGAT CTGATGCATG 10750 10760 10770 10780 10790 10800 ATAACCTAAA CCTACTCCAA TGCTAAAACT AATCGTCCCA ACAATTATAT TACTACCACT TATTGGATTT GGATGAGGTT ACGATTTTGA TTAGCAGGGT TGTTAATATA ATGATGGTGA 10810 10820 10830 10840 10850 10860 GACATGACTT TCCAAAAAAC ACATAATTTG AATCAACACA ACCACCCACA GCCTAATTAT CTGTACTGAA AGGTTTTTTG TGTATTAAAC TTAGTTGTGT TGGTGGGTGT CGGATTAATA 10870 10880 10890 10900 10910 10920 TAGCATCATC CCTCTACTAT TTTTTAACCA AATCAACAAC AACCTATTTA GCTGTTCCCC ATCGTAGTAG GGAGATGATA AAAAATTGGT TTAGTTGTTG TTGGATAAAT CGACAAGGGG 10930 10940 10950 10960 10970 10980 AACCTTTTCC TCCGACCCCC TAACAACCCC CCTCCTAATA CTAACTACCT GACTCCTACC TTGGAAAAGG AGGCTGGGGG ATTGTTGGGG GGAGGATTAT GATTGATGGA CTGAGGATGG 10990 11000 11010 11020 11030 11040 CCTCACAATC ATGGCAAGCC AACGCCACTT ATCCAGTGAA CCACTATCAC GAAAAAAACT GGAGTGTTAG TACCGTTCGG TTGCGGTGAA TAGGTCACTT GGTGATAGTG CTTTTTTTGA 11050 11060 11070 11080 11090 11100 CTACCTCTCT ATACTAATCT CCCTACAAAT CTCCTTAATT ATAACATTCA CAGCCACAGA GATGGAGAGA TATGATTAGA GGGATGTTTA GAGGAATTAA TATTGTAAGT GTCGGTGTCT 11110 11120 11130 11140 11150 11160 ACTAATCATA TTTTATATCT TCTTCGAAAC CACACTTATC CCCACCTTGG CTATCATCAC TGATTAGTAT AAAATATAGA AGAAGCTTTG GTGTGAATAG GGGTGGAACC GATAGTAGTG 11170 11180 11190 11200 11210 11220 CCGATGAGGC AACCAGCCAG AACGCCTGAA CGCAGGCACA TACTTCCTAT TCTACACCCT GGCTACTCCG TTGGTCGGTC TTGCGGACTT GCGTCCGTGT ATGAAGGATA AGATGTGGGA 11230 11240 11250 11260 11270 11280 AGTAGGCTCC CTTCCCCTAC TCATCGCACT AATTTACACT CACAACACCC TAGGCTCACT TCATCCGAGG GAAGGGGATG AGTAGCGTGA TTAAATGTGA GTGTTGTGGG ATCCGAGTGA 11290 11300 11310 11320 11330 11340 AAACATTCTA CTACTCACTC TCACTGCCCA AGAACTATCA AACTCCTGAG CCAA C AACTT Back to Top TTTGTAAGAT GATGAGTGAG AGTGACGGGT TCTTGATAGT TTGAGGACTC GGTT G TTGAA 11350 11360 11370 11380 11390 11400 AATATGACTA GCTTACACAA TAGCTTTTAT AGTAAAGATA CCTCTTTACG GACTCCACTT TTATACTGAT CGAATGTGTT ATCGAAAATA TCATTTCTAT GGAGAAATGC CTGAGGTGAA 11410 11420 11430 11440 11450 11460 ATGACTCCCT AAAGCCCATG TCGAAGCCCC CATCGCTGGG TCAATAGTAC TTGCCGCAGT TACTGAGGGA TTTCGGGTAC AGCTTCGGGG GTAGCGACCC AGTTATCATG AACGGCGTCA 11470 11480 11490 11500 11510 11520 ACTCTTAAAA CTAGGCGGCT ATGGTATAAT ACGCCTCACA CTCATTCTCA ACCCCCTGAC TGAGAATTTT GATCCGCCGA TACCATATTA TGCGGAGTGT GAGTAAGAGT TGGGGGACTG 11530 11540 11550 11560 11570 11580 AAAACACATA GCCTACCCCT TCCTTGTACT ATCCCTATGA GGCATAATTA TAACAAGCTC TTTTGTGTAT CGGATGGGGA AGGAACATGA TAGGGATACT CCGTATTAAT ATTGTTCGAG 11590 11600 11610 11620 11630 11640 CATCTGCCTA CGACAAACAG ACCTAAAATC GCTCATTGCA TACTCTTCAA TCAGCCACAT GTAGACGGAT GCTGTTTGTC TGGATTTTAG CGAGTAACGT ATGAGAAGTT AGTCGGTGTA 11650 11660 11670 11680 11690 11700 AGCCCTCGTA GTAACAGCCA TTCTCATCCA AACCCCCTGA AGCTTCACCG GCGCAGTCAT TCGGGAGCAT CATTGTCGGT AAGAGTAGGT TTGGGGGACT TCGAAGTGGC CGCGTCAGTA 11710 11720 11730 11740 11750 11760 TCTCATAATC GCCCACGGGC TTACATCCTC ATTACTATTC TGCCTAGCAA ACTCAAACTA AGAGTATTAG CGGGTGCCCG AATGTAGGAG TAATGATAAG ACGGATCGTT TGAGTTTGAT 11770 11780 11790 11800 11810 11820 CGAACGCACT CACAGTCGCA TCATAATCCT CTCTCAAGGA CTTCAAACTC TACTCCCACT GCTTGCGTGA GTGTCAGCGT AGTATTAGGA GAGAGTTCCT GAAGTTTGAG ATGAGGGTGA 11830 11840 11850 11860 11870 11880 AATAGCTTTT TGATGACTTC TAGCAAGCCT CGCTAACCTC GCCTTACCCC CCACTATTAA TTATCGAAAA ACTACTGAAG ATCGTTCGGA GCGATTGGAG CGGAATGGGG GGTGATAATT 11890 11900 11910 11920 11930 11940 CCTACTGGGA GAACTCTCTG TGCTAGTAAC CACGTTCTCC TGATCAAATA TCACTCTCCT GGATGACCCT CTTGAGAGAC ACGATCATTG GTGCAAGAGG ACTAGTTTAT AGTGAGAGGA 11950 11960 11970 11980 11990 12000 ACTTACAGGA CTCAACATAC TAGTCACAGC CCTATACTCC CTCTACATAT TTACCACAAC TGAATGTCCT GAGTTGTATG ATCAGTGTCG GGATATGAGG GAGATGTATA AATGGTGTTG 12010 12020 12030 12040 12050 12060 ACAATGGGGC TCACTCACCC ACCACATTAA CAACATAAAA CCCTCATTCA CACGAGAAAA TGTTACCCCG AGTGAGTGGG TGGTGTAATT GTTGTATTTT GGGAGTAAGT GTGCTCTTTT 12070 12080 12090 12100 12110 12120 CACCCTCATG TTCATACACC TATCCCCCAT TCTCCTCCTA TCCCTCAACC CCGACATCAT GTGGGAGTAC AAGTATGTGG ATAGGGGGTA AGAGGAGGAT AGGGAGTTGG GGCTGTAGTA 12130 12140 12150 12160 12170 12180 TACCGGGTTT TCCTCTTGTA AATATAGTTT AACCAAAACA TCAGATTGTG AATCTGACAA ATGGCCCAAA AGGAGAACAT TTATATCAAA TTGGTTTTGT AGTCTAACAC TTAGACTGTT 12190 12200 12210 12220 12230 12240 CAGAGGCTTA CGACCCCTTA TTTACCGAGA AAGCTCACAA GAACTGCTAA CTCATGCCCC GTCTCCGAAT GCTGGGGAAT AAATGGCTCT TTCGAGTGTT CTTGACGATT GAGTACGGGG 12250 12260 12270 12280 12290 12300 CATGTCTAAC AACATGGCTT TCTCAACTTT TAAAGGATAA CAGCTATCCA TTGGTCTTAG GTACAGATTG TTGTACCGAA AGAGTTGAAA ATTTCCTATT GTCGATAGGT AACCAGAATC 12310 12320 12330 12340 12350 12360 GCCCCAAAAA TTTTGGTGCA ACTCCAAATA AAAGTAATAA CCATGCACAC TACTATAACC CGGGGTTTTT AAAACCACGT TGAGGTTTAT TTTCATTATT GGTACGTGTG ATGATATTGG 12370 12380 12390 12400 12410 12420 ACCCTAACCC TGACTTCCCT AATTCCCCCC ATCCTTACCA CCCTCGTTAA CCCTAACAAA TGGGATTGGG ACTGAAGGGA TTAAGGGGGG TAGGAATGGT GGGAGCAATT GGGATTGTTT 12430 12440 12450 12460 12470 12480 AAAAACTCAT ACCCCCATTA TGTAAAATCC ATTGTCGCAT CCACCTTTAT TATCAGTCTC TTTTTGAGTA TGGGGGTAAT ACATTTTAGG TAACAGCGTA GGTGGAAATA ATAGTCAGAG 12490 12500 12510 12520 12530 12540 TTCCCCACAA CAATATTCAT GTGCCTAGAC CAAGAAGTTA TTATCTCGAA CTGACACTGA AAGGGGTGTT GTTATAAGTA CACGGATCTG GTTCTTCAAT AATAGAGCTT GACTGTGACT 12550 12560 12570 12580 12590 12600 GCCACAACCC AAACAACCCA GCTCTCCCTA AGCTTCAAAC TAGACTACTT CTCCATAATA CGGTGTTGGG TTTGTTGGGT CGAGAGGGAT TCGAAGTTTG ATCTGATGAA GAGGTATTAT 12610 12620 12630 12640 12650 12660 TTCATCCCTG TAGCATTGTT CGTTACATGG TCCATCATAG AATTCTCACT GTGATATATA AAGTAGGGAC ATCGTAACAA GCAATGTACC AGGTAGTATC TTAAGAGTGA CACTATATAT 12670 12680 12690 12700 12710 12720 AACTCAGACC CAAACATTAA TCAGTTCTTC AAATATCTAC TCATCTTCCT AATTACCATA TTGAGTCTGG GTTTGTAATT AGTCAAGAAG TTTATAGATG AGTAGAAGGA TTAATGGTAT 12730 12740 12750 12760 12770 12780 CTAATCTTAG TTACCGCTAA CAACCTATTC CAACTGTTCA TCGGCTGAGA GGGCGTAGGA GATTAGAATC AATGGCGATT GTTGGATAAG GTTGACAAGT AGCCGACTCT CCCGCATCCT 12790 12800 12810 12820 12830 12840 ATTATATCCT TCTTGCTCAT CAGTTGATGA TACGCCCGAG CAGATGCCAA CACAGCAGCC TAATATAGGA AGAACGAGTA GTCAACTACT ATGCGGGCTC GTCTACGGTT GTGTCGTCGG 12850 12860 12870 12880 12890 12900 ATTCAAGCAA TCCTATACAA CCGTATCGGC GATATCGGTT TCATCCTCGC CTTAGCATGA TAAGTTCGTT AGGATATGTT GGCATAGCCG CTATAGCCAA AGTAGGAGCG GAATCGTACT 12910 12920 12930 12940 12950 12960 TTTATCCTAC ACTCCAACTC ATGAGACCCA CAACAAATAG CCCTTCTAAA CGCTAATCCA AAATAGGATG TGAGGTTGAG TACTCTGGGT GTTGTTTATC GGGAAGATTT GCGATTAGGT 12970 12980 12990 13000 13010 13020 AGCCTCACCC CACTACTAGG CCTCCTCCTA GCAGCAGCAG GCAAATCAGC CCAATTAGGT TCGGAGTGGG GTGATGATCC GGAGGAGGAT CGTCGTCGTC CGTTTAGTCG GGTTAATCCA 13030 13040 13050 13060 13070 13080 CTCCACCCCT GACTCCCCTC AGCCATAGAA GGCCCCACCC CAGTCTCAGC CCTACTCCAC GAGGTGGGGA CTGAGGGGAG TCGGTATCTT CCGGGGTGGG GTCAGAGTCG GGATGAGGTG 13090 13100 13110 13120 13130 13140 TCAAGCACTA TAGTTGTAGC AGGAATCTTC TTACTCATCC GCTTCCACCC CCTAGCAGAA AGTTCGTGAT ATCAACATCG TCCTTAGAAG AATGAGTAGG CGAAGGTGGG GGATCGTCTT 13150 13160 13170 13180 13190 13200 AATAGCCCAC TAATCCAAAC TCTAACACTA TGCTTAGGCG CTATCACCAC TCTGTTCGCA TTATCGGGTG ATTAGGTTTG AGATTGTGAT ACGAATCCGC GATAGTGGTG AGACAAGCGT 13210 13220 13230 13240 13250 13260 GCAGTCTGCG CCCTTACACA AAATGACATC AAAAAAATCG TAGCCTTCTC CACTTCAAGT CGTCAGACGC GGGAATGTGT TTTACTGTAG TTTTTTTAGC ATCGGAAGAG GTGAAGTTCA 13270 13280 13290 13300 13310 13320 CAACTAGGAC TCATAATAGT TACAATCGGC ATCAACCAAC CACACCTAGC ATTCCTGCAC GTTGATCCTG AGTATTATCA ATGTTAGCCG TAGTTGGTTG GTGTGGATCG TAAGGACGTG 13330 13340 13350 13360 13370 13380 ATCTGTACCC ACGCCTTCTT CAAAGCCATA CTATTTATGT GCTCCGGGTC CATCATCCAC TAGACATGGG TGCGGAAGAA GTTTCGGTAT GATAAATACA CGAGGCCCAG GTAGTAGGTG 13390 13400 13410 13420 13430 13440 AACCTTAACA ATGAACAAGA TATTCGAAAA ATAGGAGGAC TACTCAAAAC CATACCTCTC TTGGAATTGT TACTTGTTCT ATAAGCTTTT TATCCTCCTG ATGAGTTTTG GTATGGAGAG 13450 13460 13470 13480 13490 13500 ACTTCAACCT CCCTCACCAT TGGCAGCCTA GCATTAGCAG GAATACCTTT CCTCACAGGT TGAAGTTGGA GGGAGTGGTA ACCGTCGGAT CGTAATCGTC CTTATGGAAA GGAGTGTCCA 13510 13520 13530 13540 13550 13560 TTCTACTCCA AAGACCACAT CATCGAAACC GCAAACATAT CATACACAAA CGCCTGAGCC AAGATGAGGT TTCTGGTGTA GTAGCTTTGG CGTTTGTATA GTATGTGTTT GCGGACTCGG 13570 13580 13590 13600 13610 13620 CTATCTATTA CTCTCATCGC TACCTCCCTG ACAAGCGCCT ATAGCACTCG AATAATTCTT GATAGATAAT GAGAGTAGCG ATGGAGGGAC TGTTCGCGGA TATCGTGAGC TTATTAAGAA 13630 13640 13650 13660 13670 13680 CTCACCCTAA CAGGTCAACC TCGCTTCCCC ACCCTTACTA ACATTAACGA AAATAACCCC GAGTGGGATT GTCCAGTTGG AGCGAAGGGG TGGGAATGAT TGTAATTGCT TTTATTGGGG 13690 13700 13710 13720 13730 13740 ACCCTACTAA ACCCCATTAA A C GCCTGGCA GCCGGAAGCC TATTCGCAGG ATTTCTCATT Back to Top TGGGATGATT TGGGGTAATT T G CGGACCGT CGGCCTTCGG ATAAGCGTCC TAAAGAGTAA 13750 13760 13770 13780 13790 13800 ACTAACAACA TTTCCCCCGC ATCCCCCTTC CAAACAACAA TCCCCCTCTA CCTAAAACTC TGATTGTTGT AAAGGGGGCG TAGGGGGAAG GTTTGTTGTT AGGGGGAGAT GGATTTTGAG 13810 13820 13830 13840 13850 13860 ACAGCCCTCG CTGTCACTTT CCTAGGACTT CTAACAGCCC TAGACCTCAA CTACCTAACC TGTCGGGAGC GACAGTGAAA GGATCCTGAA GATTGTCGGG ATCTGGAGTT GATGGATTGG 13870 13880 13890 13900 13910 13920 AACAAACTTA AAATAAAATC CCCACTATGC ACATTTTATT TCTCCAACAT ACTCGGATTC TTGTTTGAAT TTTATTTTAG GGGTGATACG TGTAAAATAA AGAGGTTGTA TGAGCCTAAG 13930 13940 13950 13960 13970 13980 TACCCTAGCA TCACACACCG CACAATCCCC TATCTAGGCC TTCTTACGAG CCAAAACCTG ATGGGATCGT AGTGTGTGGC GTGTTAGGGG ATAGATCCGG AAGAATGCTC GGTTTTGGAC 13990 14000 14010 14020 14030 14040 CCCCTACTCC TCCTAGACCT AACCTGACTA GAAAAGCTAT TACCTAAAAC AATTTCACAG GGGGATGAGG AGGATCTGGA TTGGACTGAT CTTTTCGATA ATGGATTTTG TTAAAGTGTC 14050 14060 14070 14080 14090 14100 CACCAAATCT CCACCTCCAT CATCACCTCA ACCCAAAAAG GCATAATTAA ACTTTACTTC GTGGTTTAGA GGTGGAGGTA GTAGTGGAGT TGGGTTTTTC CGTATTAATT TGAAATGAAG 14110 14120 14130 14140 14150 14160 CTCTCTTTCT TCTTCCCACT CATCCTAACC CTACTCCTAA TCACATAACC TATTCCCCCG GAGAGAAAGA AGAAGGGTGA GTAGGATTGG GATGAGGATT AGTGTATTGG ATAAGGGGGC 14170 14180 14190 14200 14210 14220 AGCAATCTCA ATTACAATAT ATACACCAAC AAACAATG T T CAACCAGTAA CTACTACTAA TCGTTAGAGT TAATGTTATA TATGTGGTTG TTTGTTAC A A GTTGGTCATT GATGATGATT 14230 14240 14250 14260 14270 14280 TCAACGCCCA TAATCATACA AAGCCCCCGC ACCAATAGGA TCCTCCCGAA T C AACCCTGA AGTTGCGGGT ATTAGTATGT TTCGGGGGCG TGGTTATCCT AGGAGGGCTT A G TTGGGACT 14290 14300 14310 14320 14330 14340 CCCCTCTCCT TCATAAATTA TTCAGCTTCC TACACTATTA AAGTTTACCA CAACCACCAC GGGGAGAGGA AGTATTTAAT AAGTCGAAGG ATGTGATAAT TTCAAATGGT GTTGGTGGTG 14350 14360 14370 14380 14390 14400 CCCATCATAC TCTTTCACCC ACAG C AC C AA TCCTACCTCC ATCGCTAACC CCACTAAAAC Back to Top GGGTAGTATG AGAAAGTGGG TGTC G TG G TT AGGATGGAGG TAGCGATTGG GGTGATTTTG 14410 14420 14430 14440 14450 14460 ACTCACCAAG ACCTCAACCC CTGACCCCCA TGCCTCAGGA TACTCCTCAA TAGCCATCGC TGAGTGGTTC TGGAGTTGGG GACTGGGGGT ACGGAGTCCT ATGAGGAGTT ATCGGTAGCG 14470 14480 14490 14500 14510 14520 TGTAGTATAT CCAAAGACAA CCATCATTCC CCCTAAATAA ATTAAAAAAA CTATTAAACC ACATCATATA GGTTTCTGTT GGTAGTAAGG GGGATTTATT TAATTTTTTT GATAATTTGG 14530 14540 14550 14560 14570 14580 CATATAACCT CCCCCAAAAT TCAGAATAAT AACACACCCG ACCACACCGC TAACAATCAA GTATATTGGA GGGGGTTTTA AGTCTTATTA TTGTGTGGGC TGGTGTGGCG ATTGTTAGTT 14590 14600 14610 14620 14630 14640 TACTAAACCC CCATAAATAG GAGAAGGCTT AGAAGAAAAC CCCACAAACC CCATTACTAA ATGATTTGGG GGTATTTATC CTCTTCCGAA TCTTCTTTTG GGGTGTTTGG GGTAATGATT 14650 14660 14670 14680 14690 14700 ACCCACACTC AACAGAAACA AAGCATACAT CATTATTCTC GCACGGACTA CAACCACGAC TGGGTGTGAG TTGTCTTTGT TTCGTATGTA GTAATAAGAG CGTGCCTGAT GTTGGTGCTG 14710 14720 14730 14740 14750 14760 CAATGATATG AAAAACCATC GTTGTATTTC AACTACAAGA ACACCAATGA CCCCAATACG GTTACTATAC TTTTTGGTAG CAACATAAAG TTGATGTTCT TGTGGTTACT GGGGTTATGC 14770 14780 14790 14800 14810 14820 CAAAA C TAAC CCCCTAATAA AATTAATTAA CCACTCATTC ATCGACCTCC CCACCCCATC Back to Top GTTTT G ATTG GGGGATTATT TTAATTAATT GGTGAGTAAG TAGCTGGAGG GGTGGGGTAG 14830 14840 14850 14860 14870 14880 CAACATCTCC GCATGATGAA ACTTCGGCTC ACTCCTTGGC GCCTGCCTGA TCCTCCAAAT GTTGTAGAGG CGTACTACTT TGAAGCCGAG TGAGGAACCG CGGACGGACT AGGAGGTTTA 14890 14900 14910 14920 14930 14940 CACCACAGGA CTATTCCTAG CCATGCACTA CTCACCAGAC GCCTCAACCG CCTTTTCATC GTGGTGTCCT GATAAGGATC GGTACGTGAT GAGTGGTCTG CGGAGTTGGC GGAAAAGTAG 14950 14960 14970 14980 14990 15000 AATCGCCCAC ATCACTCGAG ACGTAAATTA TGGCTGAATC ATCCGCTACC TTCACGCCAA TTAGCGGGTG TAGTGAGCTC TGCATTTAAT ACCGACTTAG TAGGCGATGG AAGTGCGGTT 15010 15020 15030 15040 15050 15060 TGGCGCCTCA ATATTCTTTA TCTGCCTCTT CCTACACATC GGGCGAGGCC TATATTACGG ACCGCGGAGT TATAAGAAAT AGACGGAGAA GGATGTGTAG CCCGCTCCGG ATATAATGCC 15070 15080 15090 15100 15110 15120 ATCATTTCTC TACTCAGAAA CCTGAAACAT CGGCATTATC CTCCTGCTTG CAACTATAGC TAGTAAAGAG ATGAGTCTTT GGACTTTGTA GCCGTAATAG GAGGACGAAC GTTGATATCG 15130 15140 15150 15160 15170 15180 AACAGCCTTC ATAGGCTATG TCCTCCCGTG AGGCCAAATA TCATTCTGAG GGGCCACAGT TTGTCGGAAG TATCCGATAC AGGAGGGCAC TCCGGTTTAT AGTAAGACTC CCCGGTGTCA 15190 15200 15210 15220 15230 15240 AATTACAAAC TTACTATCCG CCATCCCATA CATTGGGACA GACCTAGTTC AATGAATCTG TTAATGTTTG AATGATAGGC GGTAGGGTAT GTAACCCTGT CTGGATCAAG TTACTTAGAC 15250 15260 15270 15280 15290 15300 AGGAGGCTAC TCAGTAGACA GTCCCACCCT CACACGATTC TTTACCTTTC ACTTCATCTT TCCTCCGATG AGTCATCTGT CAGGGTGGGA GTGTGCTAAG AAATGGAAAG TGAAGTAGAA 15310 15320 15330 15340 15350 15360 GCCCTTCATT ATTGCAGCCC TAGCA A CACT CCACCTCCTA TTCTTGCACG AAACGGGATC Back to Top CGGGAAGTAA TAACGTCGGG ATCGT T GTGA GGTGGAGGAT AAGAACGTGC TTTGCCCTAG 15370 15380 15390 15400 15410 15420 AAACAACCCC CTAGGAATCA CCTCCCATTC CGATAAAATC ACCTTCCACC CTTACTACAC TTTGTTGGGG GATCCTTAGT GGAGGGTAAG GCTATTTTAG TGGAAGGTGG GAATGATGTG 15430 15440 15450 15460 15470 15480 AATCAAAGAC GCCCTCGGCT TACTTCTCTT CCTTCTCTCC TTAATGACAT TAACACTATT TTAGTTTCTG CGGGAGCCGA ATGAAGAGAA GGAAGAGAGG AATTACTGTA ATTGTGATAA 15490 15500 15510 15520 15530 15540 CTCACCAGAC CTCCTAGGCG ACCCAGACAA TTATACCCTA GCCAACCCCT TAAACACCCC GAGTGGTCTG GAGGATCCGC TGGGTCTGTT AATATGGGAT CGGTTGGGGA ATTTGTGGGG 15550 15560 15570 15580 15590 15600 TCCCCACATC AAGCCCGAAT GATATTTCCT ATTCGCCTAC ACAATTCTCC GATCCGTCCC AGGGGTGTAG TTCGGGCTTA CTATAAAGGA TAAGCGGATG TGTTAAGAGG CTAGGCAGGG 15610 15620 15630 15640 15650 15660 TAACAAACTA GGAGGCGTCC TTGCCCTATT ACTATCCATC CTCATCCTAG CAATAATCCC ATTGTTTGAT CCTCCGCAGG AACGGGATAA TGATAGGTAG GAGTAGGATC GTTATTAGGG 15670 15680 15690 15700 15710 15720 CATCCTCCAT ATATCCAAAC AACAAAGCAT AATATTTCGC CCACTAAGCC AATCACTTTA GTAGGAGGTA TATAGGTTTG TTGTTTCGTA TTATAAAGCG GGTGATTCGG TTAGTGAAAT 15730 15740 15750 15760 15770 15780 TTGACTCCTA GCCGCAGACC TCCTCATTCT AACCTGAATC GGAGGACAAC CAGTAAGCTA AACTGAGGAT CGGCGTCTGG AGGAGTAAGA TTGGACTTAG CCTCCTGTTG GTCATTCGAT 15790 15800 15810 15820 15830 15840 CCCTTTTACC ATCATTGGAC AAGTAGCATC CGTACTATAC TTCACAACAA TCCTAATCCT GGGAAAATGG TAGTAACCTG TTCATCGTAG GCATGATATG AAGTGTTGTT AGGATTAGGA 15850 15860 15870 15880 15890 15900 AATACCAACT ATCTCCCTAA TTGAAAACAA AATACTCAAA TGGGCCTGTC CTTGTAGTAT TTATGGTTGA TAGAGGGATT AACTTTTGTT TTATGAGTTT ACCCGGACAG GAACATCATA 15910 15920 15930 15940 15950 15960 AAACTAATAC ACCAGTCTTG TAAACCGGAG ATGAAAACCT TTTTCCAAGG ACAAATCAGA TTTGATTATG TGGTCAGAAC ATTTGGCCTC TACTTTTGGA AAAAGGTTCC TGTTTAGTCT 15970 15980 15990 16000 16010 16020 GAAAAAGTCT TTAACTCCAC CATTAGCACC CAAAGCTAAG ATTCTAATTT AAACTATTCT CTTTTTCAGA AATTGAGGTG GTAATCGTGG GTTTCGATTC TAAGATTAAA TTTGATAAGA 16030 16040 16050 16060 16070 16080 CTGTTCTTTC ATGGGGAAGC AGATTTGGGT ACCACCCAAG TATTGACTCA CCCATCAACA GACAAGAAAG TACCCCTTCG TCTAAACCCA TGGTGGGTTC ATAACTGAGT GGGTAGTTGT 16090 16100 16110 16120 16130 16140 ACCGCTATGT ATTTCGTACA TTACTGCCAG CCACCATGAA TATTGTACGG TACCATAAAT TGGCGATACA TAAAGCATGT AATGACGGTC GGTGGTACTT ATAACATGCC ATGGTATTTA 16150 16160 16170 16180 16190 16200 ACTTGACCAC CTGTAGTACA TAAAAACCCA ATCCACATCA AAACCCCCTC CCCATGCTTA TGAACTGGTG GACATCATGT ATTTTTGGGT TAGGTGTAGT TTTGGGGGAG GGGTACGAAT 16210 16220 16230 16240 16250 16260 CAAGCAAGTA CAGCAATCAA CCCTCAACTA TCACACATCA ACTGCAACTC CAAAGCCACC GTTCGTTCAT GTCGTTAGTT GGGAGTTGAT AGTGTGTAGT TGACGTTGAG GTTTCGGTGG 16270 16280 16290 16300 16310 16320 CCTCACCCAC TAGGATACCA ACAAACCTAC CCACCCTTAA CAGTACATAG TACATAAAGC GGAGTGGGTG ATCCTATGGT TGTTTGGATG GGTGGGAATT GTCATGTATC ATGTATTTCG 16330 16340 16350 16360 16370 16380 CATTTACCGT ACATAGCACA TTACAGTCAA ATCCCTTCTC GTCCCCATGG ATGACCCCCC GTAAATGGCA TGTATCGTGT AATGTCAGTT TAGGGAAGAG CAGGGGTACC TACTGGGGGG 16390 16400 16410 16420 16430 16440 TCAGATAGGG GTCCCTTGAC CACCATCCTC CGTGAAATCA ATATCCCGCA CAAGAGTGCT AGTCTATCCC CAGGGAACTG GTGGTAGGAG GCACTTTAGT TATAGGGCGT GTTCTCACGA 16450 16460 16470 16480 16490 16500 ACTCTCCTCG CTCCGGGCCC ATAACACTTG GGGGTAGCTA AAGTGAACTG TATCCGACAT TGAGAGGAGC GAGGCCCGGG TATTGTGAAC CCCCATCGAT TTCACTTGAC ATAGGCTGTA 16510 16520 16530 16540 16550 16560 CTGGTTCCTA CTTCAGGGTC ATAAAGCCTA AATAGCCCAC ACGTTCCCCT TAAATAAGAC GACCAAGGAT GAAGTCCCAG TATTTCGGAT TTATCGGGTG TGCAAGGGGA ATTTATTCTG 16569 ATCACGATG TAGTGCTAC

LOCUS       NC_012920      16569 bp    DNA     circular   PRI 8-JUL-2009
DEFINITION  Homo sapiens mitochondrion, complete genome.
ACCESSION   NC_012920 AC_000021
VERSION     NC_012920.1  GI:251831106
PROJECT     GenomeProject:30353
KEYWORDS    .
SOURCE      mitochondrion Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
FEATURES             Location/Qualifiers
     source          1..16569
                     /organism="Homo sapiens"
                     /organelle="mitochondrion"

                     /mol_type="genomic DNA"
                     /isolation_source="caucasian"
                     /db_xref="taxon:9606"
                     /tissue_type="placenta"
                     /country="United Kingdom: Great Britain"

                     /note="this is the rCRS"
     D-loop          complement(join(16024..16569,1..576))
     gene            577..647
                     /gene="TRNF"
                     /nomenclature="Official Symbol: MT-TF | Name:
                     mitochondrially encoded tRNA phenylalanine | Provided by:
                     HGNC:7481"
                     /db_xref="GeneID:4558"
                     /db_xref="HGNC:7481"

     tRNA            577..647
                     /gene="TRNF"
                     /product="tRNA-Phe"
                     /note="NAR: 1455"
                     /anticodon=(pos:611..613,aa:Phe)
                     /codon_recognized="UUC"
                     /db_xref="GeneID:4558"

                     /db_xref="HGNC:7481"
     gene            648..1601
                     /gene="RNR1"
                     /synonym="MTRNR1"
                     /nomenclature="Official Symbol: MT-RNR1 | Name:
                     mitochondrially encoded 12S RNA | Provided by: HGNC:7470"
                     /db_xref="GeneID:4549"

                     /db_xref="HGNC:7470"
     rRNA            648..1601
                     /gene="RNR1"
                     /product="s-rRNA"
                     /note="12S rRNA; 12S ribosomal RNA"
                     /db_xref="GeneID:4549"

                     /db_xref="HGNC:7470"
     gene            1602..1670
                     /gene="TRNV"
                     /synonym="MTTV"
                     /nomenclature="Official Symbol: MT-TV | Name:
                     mitochondrially encoded tRNA valine | Provided by:
                     HGNC:7500"
                     /db_xref="GeneID:4577"

                     /db_xref="HGNC:7500"
     tRNA            1602..1670
                     /gene="TRNV"
                     /product="tRNA-Val"
                     /note="NAR: 2053"
                     /anticodon=(pos:1633..1635,aa:Val)
                     /codon_recognized="GUA"

                     /db_xref="GeneID:4577"
                     /db_xref="HGNC:7500"
     gene            1671..3229
                     /gene="RNR2"
                     /synonym="MTRNR2"
                     /nomenclature="Official Symbol: MT-RNR2 | Name:
                     mitochondrially encoded 16S RNA | Provided by: HGNC:7471"

                     /db_xref="GeneID:4550"
                     /db_xref="HGNC:7471"
     rRNA            1671..3229
                     /gene="RNR2"
                     /product="l-rRNA"
                     /note="16S ribosomal RNA; 16S rRNA"

                     /db_xref="GeneID:4550"
                     /db_xref="HGNC:7471"
     misc_feature    3107
                     /note="preserves historical genome annotation numbering"
     gene            3230..3304
                     /gene="TRNL1"
                     /synonym="MTTL1"

                     /nomenclature="Official Symbol: MT-TL1 | Name:
                     mitochondrially encoded tRNA leucine 1 (UUA/G) | Provided
                     by: HGNC:7490"
                     /db_xref="GeneID:4567"
                     /db_xref="HGNC:7490"
     tRNA            3230..3304
                     /gene="TRNL1"
                     /product="tRNA-Leu"

                     /note="NAR: 1054"
                     /anticodon=(pos:3265..3267,aa:Leu)
                     /codon_recognized="UUR"
                     /db_xref="GeneID:4567"
                     /db_xref="HGNC:7490"
     gene            3307..4262
                     /gene="ND1"

                     /synonym="MTND1"
                     /nomenclature="Official Symbol: MT-ND1 | Name:
                     mitochondrially encoded NADH dehydrogenase 1 | Provided
                     by: HGNC:7455"
                     /db_xref="GeneID:4535"
                     /db_xref="HGNC:7455"
     CDS             3307..4262
                     /gene="ND1"

                     /note="NADH dehydrogenase, subunit 1 (complex I); TAA stop
                     codon is completed by the addition of 3' A residues to the
                     mRNA"
                     /codon_start=1
                     /transl_except=(pos:4261..4262,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 1"
                     /protein_id="AP_000639.1"
                     /db_xref="GI:58615663"
                     /db_xref="GeneID:4535"

                     /db_xref="HGNC:7455"
                     /translation="MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYG
                     LLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGL
                     LFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSF
                     NLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAG
                     PFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTA
                     YPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT"
     gene            4263..4331
                     /gene="TRNI"
                     /synonym="MTTI"
                     /nomenclature="Official Symbol: MT-TI | Name:
                     mitochondrially encoded tRNA isoleucine | Provided by:
                     HGNC:7488"

                     /db_xref="GeneID:4565"
                     /db_xref="HGNC:7488"
     tRNA            4263..4331
                     /gene="TRNI"
                     /product="tRNA-Ile"
                     /note="NAR: 0997"

                     /anticodon=(pos:4292..4294,aa:Ile)
                     /codon_recognized="AUC"
                     /db_xref="GeneID:4565"
                     /db_xref="HGNC:7488"
     gene            complement(4329..4400)
                     /gene="TRNQ"
                     /synonym="MTTQ"

                     /nomenclature="Official Symbol: MT-TQ | Name:
                     mitochondrially encoded tRNA glutamine | Provided by:
                     HGNC:7495"
                     /db_xref="GeneID:4572"
                     /db_xref="HGNC:7495"
     tRNA            complement(4329..4400)
                     /gene="TRNQ"
                     /product="tRNA-Gln"

                     /note="NAR: 0597"
                     /anticodon=(pos:complement(4365..4367),aa:Gln)
                     /codon_recognized="CAA"
                     /db_xref="GeneID:4572"
                     /db_xref="HGNC:7495"
     gene            4402..4469
                     /gene="TRNM"

                     /synonym="MTTM"
                     /nomenclature="Official Symbol: MT-TM | Name:
                     mitochondrially encoded tRNA methionine | Provided by:
                     HGNC:7492"
                     /db_xref="GeneID:4569"
                     /db_xref="HGNC:7492"
     tRNA            4402..4469
                     /gene="TRNM"

                     /product="tRNA-Met"
                     /note="NAR: 1297"
                     /anticodon=(pos:4432..4434,aa:Met)
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4569"
                     /db_xref="HGNC:7492"

     gene            4470..5511
                     /gene="ND2"
                     /synonym="MTND2"
                     /nomenclature="Official Symbol: MT-ND2 | Name:
                     mitochondrially encoded NADH dehydrogenase 2 | Provided
                     by: HGNC:7456"
                     /db_xref="GeneID:4536"
                     /db_xref="HGNC:7456"

     CDS             4470..5511
                     /gene="ND2"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:5511,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 2"
                     /protein_id="AP_000640.1"
                     /db_xref="GI:58615664"

                     /db_xref="GeneID:4536"
                     /db_xref="HGNC:7456"
                     /translation="MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVL
                     TKKMNPRSTEAAIKYFLTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAM
                     AMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSIL
                     SIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLL
                     LNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSL
                     IIPTIMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTT
                     LLLPISPFMLMIL"
     gene            5512..5579
                     /gene="TRNW"
                     /synonym="MTTW"

                     /nomenclature="Official Symbol: MT-TW | Name:
                     mitochondrially encoded tRNA tryptophan | Provided by:
                     HGNC:7501"
                     /db_xref="GeneID:4578"
                     /db_xref="HGNC:7501"
     tRNA            5512..5579
                     /gene="TRNW"
                     /product="tRNA-Trp"

                     /note="NAR: 1897"
                     /anticodon=(pos:5544..5546,aa:Trp)
                     /codon_recognized="UGA"
                     /db_xref="GeneID:4578"
                     /db_xref="HGNC:7501"
     gene            complement(5587..5655)
                     /gene="TRNA"

                     /synonym="MTTA"
                     /nomenclature="Official Symbol: MT-TA | Name:
                     mitochondrially encoded tRNA alanine | Provided by:
                     HGNC:7475"
                     /db_xref="GeneID:4553"
                     /db_xref="HGNC:7475"
     tRNA            complement(5587..5655)
                     /gene="TRNA"

                     /product="tRNA-Ala"
                     /note="NAR: 0097"
                     /anticodon=(pos:complement(5623..5625),aa:Ala)
                     /codon_recognized="GCA"
                     /db_xref="GeneID:4553"
                     /db_xref="HGNC:7475"

     gene            complement(5657..5729)
                     /gene="TRNN"
                     /synonym="MTTN"
                     /nomenclature="Official Symbol: MT-TN | Name:
                     mitochondrially encoded tRNA asparagine | Provided by:
                     HGNC:7493"
                     /db_xref="GeneID:4570"
                     /db_xref="HGNC:7493"

     tRNA            complement(5657..5729)
                     /gene="TRNN"
                     /product="tRNA-Asn"
                     /note="NAR: 0297"
                     /anticodon=(pos:complement(5694..5696),aa:Asn)
                     /codon_recognized="AAC"
                     /db_xref="GeneID:4570"

                     /db_xref="HGNC:7493"
     gene            complement(5761..5826)
                     /gene="TRNC"
                     /synonym="MTTC"
                     /nomenclature="Official Symbol: MT-TC | Name:
                     mitochondrially encoded tRNA cysteine | Provided by:
                     HGNC:7477"
                     /db_xref="GeneID:4511"

                     /db_xref="HGNC:7477"
     tRNA            complement(5761..5826)
                     /gene="TRNC"
                     /product="tRNA-Cys"
                     /note="NAR: 0497"
                     /anticodon=(pos:complement(5796..5798),aa:Cys)
                     /codon_recognized="UGC"

                     /db_xref="GeneID:4511"
                     /db_xref="HGNC:7477"
     gene            complement(5826..5891)
                     /gene="TRNY"
                     /synonym="MTTY"
                     /nomenclature="Official Symbol: MT-TY | Name:
                     mitochondrially encoded tRNA tyrosine | Provided by:
                     HGNC:7502"

                     /db_xref="GeneID:4579"
                     /db_xref="HGNC:7502"
     tRNA            complement(5826..5891)
                     /gene="TRNY"
                     /product="tRNA-Tyr"
                     /note="NAR: 1997"

                     /anticodon=(pos:complement(5860..5862),aa:Tyr)
                     /codon_recognized="UAC"
                     /db_xref="GeneID:4579"
                     /db_xref="HGNC:7502"
     gene            5904..7445
                     /gene="COX1"
                     /synonym="MTCO1, COI"

                     /nomenclature="Official Symbol: MT-COI | Name:
                     mitochondrially encoded cytochrome c oxidase I | Provided
                     by: HGNC:7419"
                     /db_xref="GeneID:4512"
                     /db_xref="HGNC:7419"
     CDS             5904..7445
                     /gene="COX1"
                     /note="cytochrome c oxidase I"

                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="AP_000641.1"
                     /db_xref="GI:58615665"
                     /db_xref="GeneID:4512"
                     /db_xref="HGNC:7419"

                     /translation="MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQP
                     GNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSF
                     WLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG
                     AINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTT
                     FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWA
                     MMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKW
                     SAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGG
                     FIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTW
                     NILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEP
                     VYMKS"
     gene            complement(7446..7514)
                     /gene="TRNS1"
                     /synonym="MTTS1"
                     /nomenclature="Official Symbol: MT-TS1 | Name:
                     mitochondrially encoded tRNA serine 1 (UCN) | Provided by:
                     HGNC:7497"
                     /db_xref="GeneID:4574"

                     /db_xref="HGNC:7497"
     tRNA            complement(7446..7514)
                     /gene="TRNS1"
                     /product="tRNA-Ser"
                     /note="NAR: 1697"
                     /anticodon=(pos:complement(7482..7484),aa:Ser)
                     /codon_recognized="UCN"

                     /db_xref="GeneID:4574"
                     /db_xref="HGNC:7497"
     gene            7518..7585
                     /gene="TRND"
                     /synonym="MTTD"
                     /nomenclature="Official Symbol: MT-TD | Name:
                     mitochondrially encoded tRNA aspartic acid | Provided by:
                     HGNC:7478"

                     /db_xref="GeneID:4555"
                     /db_xref="HGNC:7478"
     tRNA            7518..7585
                     /gene="TRND"
                     /product="tRNA-Asp"
                     /note="NAR: 0397"

                     /anticodon=(pos:7548..7550,aa:Asp)
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4555"
                     /db_xref="HGNC:7478"
     gene            7586..8269
                     /gene="COX2"
                     /synonym="MTCO2, COII"

                     /nomenclature="Official Symbol: MT-CO2 | Name:
                     mitochondrially encoded cytochrome c oxidase II | Provided
                     by: HGNC:7421"
                     /db_xref="GeneID:4513"
                     /db_xref="HGNC:7421"
     CDS             7586..8269
                     /gene="COX2"
                     /note="cytochrome c oxidase II"

                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="AP_000642.1"
                     /db_xref="GI:58615666"
                     /db_xref="GeneID:4513"
                     /db_xref="HGNC:7421"

                     /translation="MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFL
                     TLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGH
                     QWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVL
                     HSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKI
                     FEMGPVFTL"
     gene            8295..8364
                     /gene="TRNK"
                     /synonym="MTTK"
                     /nomenclature="Official Symbol: MT-TK | Name:
                     mitochondrially encoded tRNA lysine | Provided by:
                     HGNC:7489"
                     /db_xref="GeneID:4566"

                     /db_xref="HGNC:7489"
     tRNA            8295..8364
                     /gene="TRNK"
                     /product="tRNA-Lys"
                     /note="NAR: 1197"
                     /anticodon=(pos:8323..8325,aa:Lys)
                     /codon_recognized="AAA"

                     /db_xref="GeneID:4566"
                     /db_xref="HGNC:7489"
     gene            8366..8572
                     /gene="ATP8"
                     /synonym="MTATP8, ATPase8"
                     /nomenclature="Official Symbol: MT-ATP8 | Name:
                     mitochondrially encoded ATP synthase 8 | Provided by:
                     HGNC:7415"

                     /db_xref="GeneID:4509"
                     /db_xref="HGNC:7415"
     CDS             8366..8572
                     /gene="ATP8"
                     /note="ATP synthase 8; ATPase subunit 8"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 8"

                     /protein_id="AP_000643.1"
                     /db_xref="GI:58615667"
                     /db_xref="GeneID:4509"
                     /db_xref="HGNC:7415"
                     /translation="MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKM
                     KNYNKPWEPKWTKICSLHSLPPQS"

     gene            8527..9207
                     /gene="ATP6"
                     /synonym="MTATP6, ATPase6"
                     /nomenclature="Official Symbol: MT-ATP6 | Name:
                     mitochondrially encoded ATP synthase 6 | Provided by:
                     HGNC:7414"
                     /db_xref="GeneID:4508"
                     /db_xref="HGNC:7414"

     CDS             8527..9207
                     /gene="ATP6"
                     /note="ATP synthase 6; ATPase subunit 6"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 6"
                     /protein_id="AP_000644.1"
                     /db_xref="GI:58615668"

                     /db_xref="GeneID:4508"
                     /db_xref="HGNC:7414"
                     /translation="MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLIT
                     TQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNL
                     AMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRL
                     TANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLV
                     SLYLHDNT"
     gene            9207..9990
                     /gene="COX3"
                     /synonym="MTCO3, COIII"

                     /nomenclature="Official Symbol: MT-CO3 | Name:
                     mitochondrially encoded cytochrome c oxidase III |
                     Provided by: HGNC:7422"
                     /db_xref="GeneID:4514"
                     /db_xref="HGNC:7422"
     CDS             9207..9990
                     /gene="COX3"
                     /note="cytochrome c oxidase III; TAA stop codon is
                     completed by the addition of 3' A residues to the mRNA"

                     /codon_start=1
                     /transl_except=(pos:9990,aa:TERM)
                     /transl_table=2
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="AP_000645.2"
                     /db_xref="GI:193885684"
                     /db_xref="GeneID:4514"
                     /db_xref="HGNC:7422"

                     /translation="MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLM
                     LGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFY
                     HSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI
                     QALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTIC
                     FIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
     gene            9991..10058
                     /gene="TRNG"
                     /synonym="MTTG"
                     /nomenclature="Official Symbol: MT-TG | Name:
                     mitochondrially encoded tRNA glycine | Provided by:
                     HGNC:7486"
                     /db_xref="GeneID:4563"

                     /db_xref="HGNC:7486"
     tRNA            9991..10058
                     /gene="TRNG"
                     /product="tRNA-Gly"
                     /note="NAR: 0797"
                     /anticodon=(pos:10021..10023,aa:Gly)
                     /codon_recognized="GGA"

                     /db_xref="GeneID:4563"
                     /db_xref="HGNC:7486"
     gene            10059..10404
                     /gene="ND3"
                     /synonym="MTND3"
                     /nomenclature="Official Symbol: MT-ND3 | Name:
                     mitochondrially encoded NADH dehydrogenase 3 | Provided
                     by: HGNC:7458"

                     /db_xref="GeneID:4537"
                     /db_xref="HGNC:7458"
     CDS             10059..10404
                     /gene="ND3"
                     /note="NADH dehydrogenase, subunit 3 (complex I); TAA stop
                     codon is completed by the addition of 3' A residues to the
                     mRNA"
                     /codon_start=1
                     /transl_except=(pos:10404,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 3"

                     /protein_id="AP_000646.1"
                     /db_xref="GI:58615670"
                     /db_xref="GeneID:4537"
                     /db_xref="HGNC:7458"
                     /translation="MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPM
                     SPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSL
                     AYEWLQKGLDWTE"

     gene            10405..10469
                     /gene="TRNR"
                     /synonym="MTTR"
                     /nomenclature="Official Symbol: MT-TR | Name:
                     mitochondrially encoded tRNA arginine | Provided by:
                     HGNC:7496"
                     /db_xref="GeneID:4573"
                     /db_xref="HGNC:7496"

     tRNA            10405..10469
                     /gene="TRNR"
                     /product="tRNA-Arg"
                     /note="NAR: 0197"
                     /anticodon=(pos:10435..10437,aa:Arg)
                     /codon_recognized="CGA"
                     /db_xref="GeneID:4573"

                     /db_xref="HGNC:7496"
     gene            10470..10766
                     /gene="ND4L"
                     /synonym="MTND4L"
                     /nomenclature="Official Symbol: MT-ND4L | Name:
                     mitochondrially encoded NADH 4L | Provided by: HGNC:7460"
                     /db_xref="GeneID:4539"

                     /db_xref="HGNC:7460"
     CDS             10470..10766
                     /gene="ND4L"
                     /note="NADH dehydrogenase, subunit 4L (complex I)"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4L"
                     /protein_id="AP_000647.1"

                     /db_xref="GI:58615671"
                     /db_xref="GeneID:4539"
                     /db_xref="HGNC:7460"
                     /translation="MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMA
                     TLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC"
     gene            10760..12137
                     /gene="ND4"

                     /synonym="MTND4"
                     /nomenclature="Official Symbol: MT-ND4 | Name:
                     mitochondrially encoded NADH dehydrogenase 4 | Provided
                     by: HGNC:7459"
                     /db_xref="GeneID:4538"
                     /db_xref="HGNC:7459"
     CDS             10760..12137
                     /gene="ND4"

                     /note="NADH dehydrogenase, subunit 4 (complex I); TAA stop
                     codon is completed by the addition of 3' A residues to the
                     mRNA"
                     /codon_start=1
                     /transl_except=(pos:12137,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4"
                     /protein_id="AP_000648.1"
                     /db_xref="GI:58615672"
                     /db_xref="GeneID:4538"

                     /db_xref="HGNC:7459"
                     /translation="MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQ
                     INNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISL
                     QISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPL
                     LIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPK
                     AHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSIC
                     LRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNY
                     ERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNIT
                     LLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLN
                     PDIITGFSS"
     gene            12138..12206
                     /gene="TRNH"
                     /synonym="MTTH"
                     /nomenclature="Official Symbol: MT-TH | Name:
                     mitochondrially encoded tRNA histidine | Provided by:
                     HGNC:7487"

                     /db_xref="GeneID:4564"
                     /db_xref="HGNC:7487"
     tRNA            12138..12206
                     /gene="TRNH"
                     /product="tRNA-His"
                     /note="NAR: 0897"

                     /anticodon=(pos:12168..12170,aa:His)
                     /codon_recognized="CAC"
                     /db_xref="GeneID:4564"
                     /db_xref="HGNC:7487"
     gene            12207..12265
                     /gene="TRNS2"
                     /synonym="MTTS2"

                     /nomenclature="Official Symbol: MT-TS2 | Name:
                     mitochondrially encoded tRNA serine 2 (AGU/C) | Provided
                     by: HGNC:7498"
                     /db_xref="GeneID:4575"
                     /db_xref="HGNC:7498"
     tRNA            12207..12265
                     /gene="TRNS2"
                     /product="tRNA-Ser"

                     /note="NAR: 1656"
                     /anticodon=(pos:12226..12228,aa:Ser)
                     /codon_recognized="AGY"
                     /db_xref="GeneID:4575"
                     /db_xref="HGNC:7498"
     gene            12266..12336
                     /gene="TRNL2"

                     /synonym="MTTL2"
                     /nomenclature="Official Symbol: MT-L2 | Name:
                     mitochondrially encoded tRNA leucine 2 (CUN) | Provided
                     by: HGNC:7491"
                     /db_xref="GeneID:4568"
                     /db_xref="HGNC:7491"
     tRNA            12266..12336
                     /gene="TRNL2"

                     /product="tRNA-Leu"
                     /note="NAR: 1097"
                     /anticodon=(pos:12298..12300,aa:Leu)
                     /codon_recognized="CUN"
                     /db_xref="GeneID:4568"
                     /db_xref="HGNC:7491"

     gene            12337..14148
                     /gene="ND5"
                     /synonym="MTND5"
                     /nomenclature="Official Symbol: MTND5 | Name:
                     mitochondrially encoded NADH dehydrogenase 5 | Provided
                     by: HGNC:7461"
                     /db_xref="GeneID:4540"
                     /db_xref="HGNC:7461"

     CDS             12337..14148
                     /gene="ND5"
                     /note="NADH dehydrogenase, subunit 5 (complex I)"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 5"
                     /protein_id="AP_000649.1"
                     /db_xref="GI:58615673"

                     /db_xref="GeneID:4540"
                     /db_xref="HGNC:7461"
                     /translation="MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTF
                     IISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIME
                     FSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYA
                     RADANTAAIQAILYNRIGDIGFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLL
                     AAAGKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTL
                     TLCLGAITTLFAAVCALTQNDIKKIVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAF
                     FKAMLFMCSGSIIHNLNNEQDIRKMGGLLKTMPLTSTSLTIGSLALAGMPFLTGFYSK
                     DHIIETANMSYTNAWALSITLIATSLTSAYSTRMILLTLTGQPRFPTLTNINENNPTL
                     LNPIKRLAAGSLFAGFLITNNISPASPFQTTIPLYLKLTALAVTFLGLLTALDLNYLT
                     NKLKMKSPLCTFYFSNMLGFYPSITHRTIPYLGLLTSQNLPLLLLDLTWLEKLLPKTI
                     SQHQISTSIITSTQKGMIKLYFLSFFFPLILTLLLIT"
     gene            complement(14149..14673)
                     /gene="ND6"
                     /synonym="MTND6"

                     /nomenclature="Official Symbol: MT-ND6 | Name:
                     mitochondrially encoded NADH dehydrogenase 6 | Provided
                     by: HGNC:7462"
                     /db_xref="GeneID:4541"
                     /db_xref="HGNC:7462"
     CDS             complement(14149..14673)
                     /gene="ND6"
                     /note="NADH dehydrogenase, subunit 6 (complex I)"

                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 6"
                     /protein_id="AP_000650.1"
                     /db_xref="GI:58615674"
                     /db_xref="GeneID:4541"
                     /db_xref="HGNC:7462"

                     /translation="MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIIL
                     NFGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGL
                     VLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTL
                     FVGVYIVIEIARGN"
     gene            complement(14674..14742)
                     /gene="TRNE"
                     /synonym="MTTE"
                     /nomenclature="Official Symbol: MT-TE | Name:
                     mitochondrially encoded tRNA glutamic acid | Provided by:
                     HGNC:7479"
                     /db_xref="GeneID:4556"

                     /db_xref="HGNC:7479"
     tRNA            complement(14674..14742)
                     /gene="TRNE"
                     /product="tRNA-Glu"
                     /note="NAR: 0697"
                     /anticodon=(pos:complement(14710..14712),aa:Glu)
                     /codon_recognized="GAA"

                     /db_xref="GeneID:4556"
                     /db_xref="HGNC:7479"
     gene            14747..15887
                     /gene="CYTB"
                     /synonym="MTCYB"
                     /nomenclature="Official Symbol: MT-CYB | Name:
                     mitochondrially encoded cytochrome b | Provided by:
                     HGNC:7427"

                     /db_xref="GeneID:4519"
                     /db_xref="HGNC:7427"
     CDS             14747..15887
                     /gene="CYTB"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:15887,aa:TERM)
                     /transl_table=2
                     /product="cytochrome b"

                     /protein_id="AP_000651.3"
                     /db_xref="GI:193885685"
                     /db_xref="GeneID:4519"
                     /db_xref="HGNC:7427"
                     /translation="MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQ
                     ITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGL
                     YYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDL
                     VQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKI
                     TFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLF
                     AYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLI
                     LTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA"

     gene            15888..15953
                     /gene="TRNT"
                     /synonym="MTTT"
                     /nomenclature="Official Symbol: MT-TT | Name:
                     mitochondrially encoded tRNA threonine | Provided by:
                     HGNC:7499"
                     /db_xref="GeneID:4576"
                     /db_xref="HGNC:7499"

     tRNA            15888..15953
                     /gene="TRNT"
                     /product="tRNA-Thr"
                     /note="NAR: 1797"
                     /anticodon=(pos:15919..15921,aa:Thr)
                     /codon_recognized="ACA"
                     /db_xref="GeneID:4576"

                     /db_xref="HGNC:7499"
     gene            complement(15956..16023)
                     /gene="TRNP"
                     /synonym="MTTP"
                     /nomenclature="Official Symbol: MT-TP | Name:
                     mitochondrially encoded tRNA proline | Provided by:
                     HGNC:7494"
                     /db_xref="GeneID:4571"

                     /db_xref="HGNC:7494"
     tRNA            complement(15956..16023)
                     /gene="TRNP"
                     /product="tRNA-Pro"
                     /note="NAR: 1597"
                     /anticodon=(pos:complement(15990..15992),aa:Pro)
                     /codon_recognized="CCA"

                     /db_xref="GeneID:4571"
                     /db_xref="HGNC:7494"                                                      

Back to Top

This topic: MITOMAP > WebHome > HumanMitoSeq2Strands
Topic revision: 07 Mar 2018, MarieLott
This site is powered by FoswikiCopyright © by the contributing authors. All material on this collaboration platform is the property of the contributing authors.
Ideas, requests, problems regarding Foswiki? Send feedback