Revised Cambridge Reference Sequence (rCRS) of the Human Mitochondrial DNA

The rCRS has a new number in GenBank! It is now officially NC_012920 gi:251831106

Get the rCRS and other complete mtDNA sequences at GenBank here.

IMPORTANT: Do not use RefSeq NC_001807 as "the rCRS" as it is an African (Yoruban) sequence with over 40 variant nucleotides from the rCRS. On July 8, 2009 the sequence was removed from GenBank as a reference sequence but may be found, if needed, as AF347015, one of 53 African sequence deposited in Genbank by Ingman et al in 2001. Unfortunately, mistaken use of this Yoruban sequence as the rCRS is still seen occasionally in new publications today.

The rCRS sequence below is the Cambridge Reference Sequence Anderson et al 1981 as revised by Andrews et al 1999. It differs from the original CRS and other complete hmtdna GenBank sequences in that it has eighteen corrected or confirmed nucleotides as annotated below. See the summary table of the reanalysis by Andrews et al.

  • Seven nucleotides are considered to be rare polymorphisms and were determined to be correct as originally sequenced (J01415 gi:337188). Nucleotides 263A, 311C-315C, 750A, 1438A, 4769A, 8860A, and 15326A are considered to be rare polymorphisms and are maintained as part of the true reference sequence. The seven rare polymorphisms are shown below in bold green letters.
  • Eleven nucleotide errors in the original CRS have been corrected by re-sequencing the original placental material. Nucleotides 3107del*, 3423T, 4985A, 9559C, 11335C, 13702C, 14199T, 14272C, 14365C, 14368C, 14766C are corrections of the original Cambridge sequence (J01415 gi:337188). The errors in the original Cambridge sequence have been attributed to sequencing errors (8 instances) and to the inclusion of bovine (2 instances) or HeLa (1 instance) DNA. See summary table. Corrected sequencing errors are shown below in bold red letters. 3107del is maintained in this revised sequence with the gap represented by an 'N'. THIS ALLOWS HISTORICAL NUCLEOTIDE NUMBERING TO BE MAINTAINED.

  • For strand composition asymmetry and an explanation of L-strand/H-strand terminology, click here.

        10         20         30         40         50         60 
GATCACAGGT CTATCACCCT ATTAACCACT CACGGGAGCT CTCCATGCAT TTGGTATTTT 
CTAGTGTCCA GATAGTGGGA TAATTGGTGA GTGCCCTCGA GAGGTACGTA AACCATAAAA 
                                                                  
        70         80         90        100        110        120 
CGTCTGGGGG GTATGCACGC GATAGCATTG CGAGACGCTG GAGCCGGAGC ACCCTATGTC 
GCAGACCCCC CATACGTGCG CTATCGTAAC GCTCTGCGAC CTCGGCCTCG TGGGATACAG 
                                                                  
       130        140        150        160        170        180 
GCAGTATCTG TCTTTGATTC CTGCCTCATC CTATTATTTA TCGCACCTAC GTTCAATATT 
CGTCATAGAC AGAAACTAAG GACGGAGTAG GATAATAAAT AGCGTGGATG CAAGTTATAA 
                                                                  
       190        200        210        220        230        240 
ACAGGCGAAC ATACTTACTA AAGTGTGTTA ATTAATTAAT GCTTGTAGGA CATAATAATA 
TGTCCGCTTG TATGAATGAT TTCACACAAT TAATTAATTA CGAACATCCT GTATTATTAT 
                                                                  
       250        260        270        280        290        300 
ACAATTGAAT GTCTGCACAG CCACTTTCCA CACAGACATC ATAACAAAAA ATTTCCACCA
TGTTAACTTA CAGACGTGTC GGTGAAAGGT GTGTCTGTAG TATTGTTTTT TAAAGGTGGT 
                                                                  
       310        320        330        340        350        360 
AACCCCCCCT CCCCCGCTTC TGGCCACAGC ACTTAAACAC ATCTCTGCCA AACCCCAAAA Back to Top
TTGGGGGGGA GGGGGCGAAG ACCGGTGTCG TGAATTTGTG TAGAGACGGT TTGGGGTTTT 
                                                                  
       370        380        390        400        410        420 
ACAAAGAACC CTAACACCAG CCTAACCAGA TTTCAAATTT TATCTTTTGG CGGTATGCAC 
TGTTTCTTGG GATTGTGGTC GGATTGGTCT AAAGTTTAAA ATAGAAAACC GCCATACGTG 
                                                                  
       430        440        450        460        470        480 
TTTTAACAGT CACCCCCCAA CTAACACATT ATTTTCCCCT CCCACTCCCA TACTACTAAT 
AAAATTGTCA GTGGGGGGTT GATTGTGTAA TAAAAGGGGA GGGTGAGGGT ATGATGATTA 
                                                                  
       490        500        510        520        530        540 
CTCATCAATA CAACCCCCGC CCATCCTACC CAGCACACAC ACACCGCTGC TAACCCCATA 
GAGTAGTTAT GTTGGGGGCG GGTAGGATGG GTCGTGTGTG TGTGGCGACG ATTGGGGTAT 
                                                                  
       550        560        570        580        590        600 
CCCCGAACCA ACCAAACCCC AAAGACACCC CCCACAGTTT ATGTAGCTTA CCTCCTCAAA 
GGGGCTTGGT TGGTTTGGGG TTTCTGTGGG GGGTGTCAAA TACATCGAAT GGAGGAGTTT 
                                                                  
       610        620        630        640        650        660 
GCAATACACT GAAAATGTTT AGACGGGCTC ACATCACCCC ATAAACAAAT AGGTTTGGTC 
CGTTATGTGA CTTTTACAAA TCTGCCCGAG TGTAGTGGGG TATTTGTTTA TCCAAACCAG 
                                                                  
       670        680        690        700        710        720 
CTAGCCTTTC TATTAGCTCT TAGTAAGATT ACACATGCAA GCATCCCCGT TCCAGTGAGT 
GATCGGAAAG ATAATCGAGA ATCATTCTAA TGTGTACGTT CGTAGGGGCA AGGTCACTCA 
                                                                  
       730        740        750        760        770        780 
TCACCCTCTA AATCACCACG ATCAAAAGGA ACAAGCATCA AGCACGCAGC AATGCAGCTC  Back to Top
AGTGGGAGAT TTAGTGGTGC TAGTTTTCCT TGTTCGTAGT TCGTGCGTCG TTACGTCGAG 
                                                                  
       790        800        810        820        830        840 
AAAACGCTTA GCCTAGCCAC ACCCCCACGG GAAACAGCAG TGATTAACCT TTAGCAATAA 
TTTTGCGAAT CGGATCGGTG TGGGGGTGCC CTTTGTCGTC ACTAATTGGA AATCGTTATT 
                                                                  
       850        860        870        880        890        900 
ACGAAAGTTT AACTAAGCTA TACTAACCCC AGGGTTGGTC AATTTCGTGC CAGCCACCGC 
TGCTTTCAAA TTGATTCGAT ATGATTGGGG TCCCAACCAG TTAAAGCACG GTCGGTGGCG 
                                                                  
       910        920        930        940        950        960 
GGTCACACGA TTAACCCAAG TCAATAGAAG CCGGCGTAAA GAGTGTTTTA GATCACCCCC 
CCAGTGTGCT AATTGGGTTC AGTTATCTTC GGCCGCATTT CTCACAAAAT CTAGTGGGGG 
                                                                  
       970        980        990       1000       1010       1020 
TCCCCAATAA AGCTAAAACT CACCTGAGTT GTAAAAAACT CCAGTTGACA CAAAATAGAC 
AGGGGTTATT TCGATTTTGA GTGGACTCAA CATTTTTTGA GGTCAACTGT GTTTTATCTG 
                                                                  
      1030       1040       1050       1060       1070       1080 
TACGAAAGTG GCTTTAACAT ATCTGAACAC ACAATAGCTA AGACCCAAAC TGGGATTAGA 
ATGCTTTCAC CGAAATTGTA TAGACTTGTG TGTTATCGAT TCTGGGTTTG ACCCTAATCT 
                                                                  
      1090       1100       1110       1120       1130       1140 
TACCCCACTA TGCTTAGCCC TAAACCTCAA CAGTTAAATC AACAAAACTG CTCGCCAGAA 
ATGGGGTGAT ACGAATCGGG ATTTGGAGTT GTCAATTTAG TTGTTTTGAC GAGCGGTCTT 
                                                                  
      1150       1160       1170       1180       1190       1200 
CACTACGAGC CACAGCTTAA AACTCAAAGG ACCTGGCGGT GCTTCATATC CCTCTAGAGG 
GTGATGCTCG GTGTCGAATT TTGAGTTTCC TGGACCGCCA CGAAGTATAG GGAGATCTCC 
                                                                  
      1210       1220       1230       1240       1250       1260 
AGCCTGTTCT GTAATCGATA AACCCCGATC AACCTCACCA CCTCTTGCTC AGCCTATATA 
TCGGACAAGA CATTAGCTAT TTGGGGCTAG TTGGAGTGGT GGAGAACGAG TCGGATATAT 
                                                                  
      1270       1280       1290       1300       1310       1320 
CCGCCATCTT CAGCAAACCC TGATGAAGGC TACAAAGTAA GCGCAAGTAC CCACGTAAAG 
GGCGGTAGAA GTCGTTTGGG ACTACTTCCG ATGTTTCATT CGCGTTCATG GGTGCATTTC 
                                                                  
      1330       1340       1350       1360       1370       1380 
ACGTTAGGTC AAGGTGTAGC CCATGAGGTG GCAAGAAATG GGCTACATTT TCTACCCCAG 
TGCAATCCAG TTCCACATCG GGTACTCCAC CGTTCTTTAC CCGATGTAAA AGATGGGGTC 
                                                                  
      1390       1400       1410       1420       1430       1440 
AAAACTACGA TAGCCCTTAT GAAACTTAAG GGTCGAAGGT GGATTTAGCA GTAAACTAAG   Back to Top
TTTTGATGCT ATCGGGAATA CTTTGAATTC CCAGCTTCCA CCTAAATCGT CATTTGATTC 
                                                                  
      1450       1460       1470       1480       1490       1500 
AGTAGAGTGC TTAGTTGAAC AGGGCCCTGA AGCGCGTACA CACCGCCCGT CACCCTCCTC 
TCATCTCACG AATCAACTTG TCCCGGGACT TCGCGCATGT GTGGCGGGCA GTGGGAGGAG 
                                                                  
      1510       1520       1530       1540       1550       1560 
AAGTATACTT CAAAGGACAT TTAACTAAAA CCCCTACGCA TTTATATAGA GGAGACAAGT 
TTCATATGAA GTTTCCTGTA AATTGATTTT GGGGATGCGT AAATATATCT CCTCTGTTCA 
                                                                  
      1570       1580       1590       1600       1610       1620 
CGTAACATGG TAAGTGTACT GGAAAGTGCA CTTGGACGAA CCAGAGTGTA GCTTAACACA 
GCATTGTACC ATTCACATGA CCTTTCACGT GAACCTGCTT GGTCTCACAT CGAATTGTGT 
                                                                  
      1630       1640       1650       1660       1670       1680 
AAGCACCCAA CTTACACTTA GGAGATTTCA ACTTAACTTG ACCGCTCTGA GCTAAACCTA 
TTCGTGGGTT GAATGTGAAT CCTCTAAAGT TGAATTGAAC TGGCGAGACT CGATTTGGAT 
                                                                  
      1690       1700       1710       1720       1730       1740 
GCCCCAAACC CACTCCACCT TACTACCAGA CAACCTTAGC CAAACCATTT ACCCAAATAA 
CGGGGTTTGG GTGAGGTGGA ATGATGGTCT GTTGGAATCG GTTTGGTAAA TGGGTTTATT 
                                                                  
      1750       1760       1770       1780       1790       1800 
AGTATAGGCG ATAGAAATTG AAACCTGGCG CAATAGATAT AGTACCGCAA GGGAAAGATG 
TCATATCCGC TATCTTTAAC TTTGGACCGC GTTATCTATA TCATGGCGTT CCCTTTCTAC 
                                                                  
      1810       1820       1830       1840       1850       1860 
AAAAATTATA ACCAAGCATA ATATAGCAAG GACTAACCCC TATACCTTCT GCATAATGAA 
TTTTTAATAT TGGTTCGTAT TATATCGTTC CTGATTGGGG ATATGGAAGA CGTATTACTT 
                                                                  
      1870       1880       1890       1900       1910       1920 
TTAACTAGAA ATAACTTTGC AAGGAGAGCC AAAGCTAAGA CCCCCGAAAC CAGACGAGCT 
AATTGATCTT TATTGAAACG TTCCTCTCGG TTTCGATTCT GGGGGCTTTG GTCTGCTCGA 
                                                                  
      1930       1940       1950       1960       1970       1980 
ACCTAAGAAC AGCTAAAAGA GCACACCCGT CTATGTAGCA AAATAGTGGG AAGATTTATA 
TGGATTCTTG TCGATTTTCT CGTGTGGGCA GATACATCGT TTTATCACCC TTCTAAATAT 
                                                                  
      1990       2000       2010       2020       2030       2040 
GGTAGAGGCG ACAAACCTAC CGAGCCTGGT GATAGCTGGT TGTCCAAGAT AGAATCTTAG 
CCATCTCCGC TGTTTGGATG GCTCGGACCA CTATCGACCA ACAGGTTCTA TCTTAGAATC 
                                                                  
      2050       2060       2070       2080       2090       2100 
TTCAACTTTA AATTTGCCCA CAGAACCCTC TAAATCCCCT TGTAAATTTA ACTGTTAGTC 
AAGTTGAAAT TTAAACGGGT GTCTTGGGAG ATTTAGGGGA ACATTTAAAT TGACAATCAG 
                                                                  
      2110       2120       2130       2140       2150       2160 
CAAAGAGGAA CAGCTCTTTG GACACTAGGA AAAAACCTTG TAGAGAGAGT AAAAAATTTA 
GTTTCTCCTT GTCGAGAAAC CTGTGATCCT TTTTTGGAAC ATCTCTCTCA TTTTTTAAAT 
                                                                  
      2170       2180       2190       2200       2210       2220 
ACACCCATAG TAGGCCTAAA AGCAGCCACC AATTAAGAAA GCGTTCAAGC TCAACACCCA 
TGTGGGTATC ATCCGGATTT TCGTCGGTGG TTAATTCTTT CGCAAGTTCG AGTTGTGGGT 
                                                                  
      2230       2240       2250       2260       2270       2280 
CTACCTAAAA AATCCCAAAC ATATAACTGA ACTCCTCACA CCCAATTGGA CCAATCTATC 
GATGGATTTT TTAGGGTTTG TATATTGACT TGAGGAGTGT GGGTTAACCT GGTTAGATAG 
                                                                  
      2290       2300       2310       2320       2330       2340 
ACCCTATAGA AGAACTAATG TTAGTATAAG TAACATGAAA ACATTCTCCT CCGCATAAGC 
TGGGATATCT TCTTGATTAC AATCATATTC ATTGTACTTT TGTAAGAGGA GGCGTATTCG 
                                                                  
      2350       2360       2370       2380       2390       2400 
CTGCGTCAGA TTAAAACACT GAACTGACAA TTAACAGCCC AATATCTACA ATCAACCAAC 
GACGCAGTCT AATTTTGTGA CTTGACTGTT AATTGTCGGG TTATAGATGT TAGTTGGTTG 
                                                                  
      2410       2420       2430       2440       2450       2460 
AAGTCATTAT TACCCTCACT GTCAACCCAA CACAGGCATG CTCATAAGGA AAGGTTAAAA 
TTCAGTAATA ATGGGAGTGA CAGTTGGGTT GTGTCCGTAC GAGTATTCCT TTCCAATTTT 
                                                                  
      2470       2480       2490       2500       2510       2520 
AAAGTAAAAG GAACTCGGCA AATCTTACCC CGCCTGTTTA CCAAAAACAT CACCTCTAGC 
TTTCATTTTC CTTGAGCCGT TTAGAATGGG GCGGACAAAT GGTTTTTGTA GTGGAGATCG 
                                                                  
      2530       2540       2550       2560       2570       2580 
ATCACCAGTA TTAGAGGCAC CGCCTGCCCA GTGACACATG TTTAACGGCC GCGGTACCCT 
TAGTGGTCAT AATCTCCGTG GCGGACGGGT CACTGTGTAC AAATTGCCGG CGCCATGGGA 
                                                                  
      2590       2600       2610       2620       2630       2640 
AACCGTGCAA AGGTAGCATA ATCACTTGTT CCTTAAATAG GGACCTGTAT GAATGGCTCC 
TTGGCACGTT TCCATCGTAT TAGTGAACAA GGAATTTATC CCTGGACATA CTTACCGAGG 
                                                                  
      2650       2660       2670       2680       2690       2700 
ACGAGGGTTC AGCTGTCTCT TACTTTTAAC CAGTGAAATT GACCTGCCCG TGAAGAGGCG 
TGCTCCCAAG TCGACAGAGA ATGAAAATTG GTCACTTTAA CTGGACGGGC ACTTCTCCGC 
                                                                  
      2710       2720       2730       2740       2750       2760 
GGCATAACAC AGCAAGACGA GAAGACCCTA TGGAGCTTTA ATTTATTAAT GCAAACAGTA 
CCGTATTGTG TCGTTCTGCT CTTCTGGGAT ACCTCGAAAT TAAATAATTA CGTTTGTCAT 
                                                                  
      2770       2780       2790       2800       2810       2820 
CCTAACAAAC CCACAGGTCC TAAACTACCA AACCTGCATT AAAAATTTCG GTTGGGGCGA 
GGATTGTTTG GGTGTCCAGG ATTTGATGGT TTGGACGTAA TTTTTAAAGC CAACCCCGCT 
                                                                  
      2830       2840       2850       2860       2870       2880 
CCTCGGAGCA GAACCCAACC TCCGAGCAGT ACATGCTAAG ACTTCACCAG TCAAAGCGAA 
GGAGCCTCGT CTTGGGTTGG AGGCTCGTCA TGTACGATTC TGAAGTGGTC AGTTTCGCTT 
                                                                  
      2890       2900       2910       2920       2930       2940 
CTACTATACT CAATTGATCC AATAACTTGA CCAACGGAAC AAGTTACCCT AGGGATAACA 
GATGATATGA GTTAACTAGG TTATTGAACT GGTTGCCTTG TTCAATGGGA TCCCTATTGT 
                                                                  
      2950       2960       2970       2980       2990       3000 
GCGCAATCCT ATTCTAGAGT CCATATCAAC AATAGGGTTT ACGACCTCGA TGTTGGATCA 
CGCGTTAGGA TAAGATCTCA GGTATAGTTG TTATCCCAAA TGCTGGAGCT ACAACCTAGT 
                                                                  
      3010       3020       3030       3040       3050       3060 
GGACATCCCG ATGGTGCAGC CGCTATTAAA GGTTCGTTTG TTCAACGATT AAAGTCCTAC 
CCTGTAGGGC TACCACGTCG GCGATAATTT CCAAGCAAAC AAGTTGCTAA TTTCAGGATG 
                                                                  
      3070       3080       3090       3100      3110       3120 
GTGATCTGAG TTCAGACCGG AGTAATCCAG GTCGGTTTCT ATCTACnTTC AAATTCCTCC  Back to Top
CACTAGACTC AAGTCTGGCC TCATTAGGTC CAGCCAAAGA TAGATGnAAG TTTAAGGAGG 
                                                                  
      3130       3140       3150       3160       3170       3180 
CTGTACGAAA GGACAAGAGA AATAAGGCCT ACTTCACAAA GCGCCTTCCC CCGTAAATGA 
GACATGCTTT CCTGTTCTCT TTATTCCGGA TGAAGTGTTT CGCGGAAGGG GGCATTTACT 
                                                                  
      3190       3200       3210       3220       3230       3240 
TATCATCTCA ACTTAGTATT ATACCCACAC CCACCCAAGA ACAGGGTTTG TTAAGATGGC 
ATAGTAGAGT TGAATCATAA TATGGGTGTG GGTGGGTTCT TGTCCCAAAC AATTCTACCG 
                                                                  
      3250       3260       3270       3280       3290       3300 
AGAGCCCGGT AATCGCATAA AACTTAAAAC TTTACAGTCA GAGGTTCAAT TCCTCTTCTT 
TCTCGGGCCA TTAGCGTATT TTGAATTTTG AAATGTCAGT CTCCAAGTTA AGGAGAAGAA 
                                                                  
      3310       3320       3330       3340       3350       3360 
AACAACATAC CCATGGCCAA CCTCCTACTC CTCATTGTAC CCATTCTAAT CGCAATGGCA 
TTGTTGTATG GGTACCGGTT GGAGGATGAG GAGTAACATG GGTAAGATTA GCGTTACCGT 
                                                                  
      3370       3380       3390       3400       3410       3420 
TTCCTAATGC TTACCGAACG AAAAATTCTA GGCTATATAC AACTACGCAA AGGCCCCAAC 
AAGGATTACG AATGGCTTGC TTTTTAAGAT CCGATATATG TTGATGCGTT TCCGGGGTTG 
                                                                  
      3430       3440       3450       3460       3470       3480 
GTTGTAGGCC CCTACGGGCT ACTACAACCC TTCGCTGACG CCATAAAACT CTTCACCAAA  Back to Top
CAACATCCGG GGATGCCCGA TGATGTTGGG AAGCGACTGC GGTATTTTGA GAAGTGGTTT 
                                                                  
      3490       3500       3510       3520       3530       3540 
GAGCCCCTAA AACCCGCCAC ATCTACCATC ACCCTCTACA TCACCGCCCC GACCTTAGCT 
CTCGGGGATT TTGGGCGGTG TAGATGGTAG TGGGAGATGT AGTGGCGGGG CTGGAATCGA 
                                                                  
      3550       3560       3570       3580       3590       3600 
CTCACCATCG CTCTTCTACT ATGAACCCCC CTCCCCATAC CCAACCCCCT GGTCAACCTC 
GAGTGGTAGC GAGAAGATGA TACTTGGGGG GAGGGGTATG GGTTGGGGGA CCAGTTGGAG 
                                                                  
      3610       3620       3630       3640       3650       3660 
AACCTAGGCC TCCTATTTAT TCTAGCCACC TCTAGCCTAG CCGTTTACTC AATCCTCTGA 
TTGGATCCGG AGGATAAATA AGATCGGTGG AGATCGGATC GGCAAATGAG TTAGGAGACT 
                                                                  
      3670       3680       3690       3700       3710       3720 
TCAGGGTGAG CATCAAACTC AAACTACGCC CTGATCGGCG CACTGCGAGC AGTAGCCCAA 
AGTCCCACTC GTAGTTTGAG TTTGATGCGG GACTAGCCGC GTGACGCTCG TCATCGGGTT 
                                                                  
      3730       3740       3750       3760       3770       3780 
ACAATCTCAT ATGAAGTCAC CCTAGCCATC ATTCTACTAT CAACATTACT AATAAGTGGC 
TGTTAGAGTA TACTTCAGTG GGATCGGTAG TAAGATGATA GTTGTAATGA TTATTCACCG 
                                                                  
      3790       3800       3810       3820       3830       3840 
TCCTTTAACC TCTCCACCCT TATCACAACA CAAGAACACC TCTGATTACT CCTGCCATCA 
AGGAAATTGG AGAGGTGGGA ATAGTGTTGT GTTCTTGTGG AGACTAATGA GGACGGTAGT 
                                                                  
      3850       3860       3870       3880       3890       3900 
TGACCCTTGG CCATAATATG ATTTATCTCC ACACTAGCAG AGACCAACCG AACCCCCTTC 
ACTGGGAACC GGTATTATAC TAAATAGAGG TGTGATCGTC TCTGGTTGGC TTGGGGGAAG 
                                                                  
      3910       3920       3930       3940       3950       3960 
GACCTTGCCG AAGGGGAGTC CGAACTAGTC TCAGGCTTCA ACATCGAATA CGCCGCAGGC 
CTGGAACGGC TTCCCCTCAG GCTTGATCAG AGTCCGAAGT TGTAGCTTAT GCGGCGTCCG 
                                                                  
      3970       3980       3990       4000       4010       4020 
CCCTTCGCCC TATTCTTCAT AGCCGAATAC ACAAACATTA TTATAATAAA CACCCTCACC 
GGGAAGCGGG ATAAGAAGTA TCGGCTTATG TGTTTGTAAT AATATTATTT GTGGGAGTGG 
                                                                  
      4030       4040       4050       4060       4070       4080 
ACTACAATCT TCCTAGGAAC AACATATGAC GCACTCTCCC CTGAACTCTA CACAACATAT 
TGATGTTAGA AGGATCCTTG TTGTATACTG CGTGAGAGGG GACTTGAGAT GTGTTGTATA 
                                                                  
      4090       4100       4110       4120       4130       4140 
TTTGTCACCA AGACCCTACT TCTAACCTCC CTGTTCTTAT GAATTCGAAC AGCATACCCC 
AAACAGTGGT TCTGGGATGA AGATTGGAGG GACAAGAATA CTTAAGCTTG TCGTATGGGG 
                                                                  
      4150       4160       4170       4180       4190       4200 
CGATTCCGCT ACGACCAACT CATACACCTC CTATGAAAAA ACTTCCTACC ACTCACCCTA 
GCTAAGGCGA TGCTGGTTGA GTATGTGGAG GATACTTTTT TGAAGGATGG TGAGTGGGAT 
                                                                  
      4210       4220       4230       4240       4250       4260 
GCATTACTTA TATGATATGT CTCCATACCC ATTACAATCT CCAGCATTCC CCCTCAAACC 
CGTAATGAAT ATACTATACA GAGGTATGGG TAATGTTAGA GGTCGTAAGG GGGAGTTTGG 
                                                                  
      4270       4280       4290       4300       4310       4320 
TAAGAAATAT GTCTGATAAA AGAGTTACTT TGATAGAGTA AATAATAGGA GCTTAAACCC 
ATTCTTTATA CAGACTATTT TCTCAATGAA ACTATCTCAT TTATTATCCT CGAATTTGGG 
                                                                  
      4330       4340       4350       4360       4370       4380 
CCTTATTTCT AGGACTATGA GAATCGAACC CATCCCTGAG AATCCAAAAT TCTCCGTGCC 
GGAATAAAGA TCCTGATACT CTTAGCTTGG GTAGGGACTC TTAGGTTTTA AGAGGCACGG 
                                                                  
      4390       4400       4410       4420       4430       4440 
ACCTATCACA CCCCATCCTA AAGTAAGGTC AGCTAAATAA GCTATCGGGC CCATACCCCG 
TGGATAGTGT GGGGTAGGAT TTCATTCCAG TCGATTTATT CGATAGCCCG GGTATGGGGC 
                                                                  
      4450       4460       4470       4480       4490       4500 
AAAATGTTGG TTATACCCTT CCCGTACTAA TTAATCCCCT GGCCCAACCC GTCATCTACT 
TTTTACAACC AATATGGGAA GGGCATGATT AATTAGGGGA CCGGGTTGGG CAGTAGATGA 
                                                                  
      4510       4520       4530       4540       4550       4560 
CTACCATCTT TGCAGGCACA CTCATCACAG CGCTAAGCTC GCACTGATTT TTTACCTGAG 
GATGGTAGAA ACGTCCGTGT GAGTAGTGTC GCGATTCGAG CGTGACTAAA AAATGGACTC 
                                                                  
      4570       4580       4590       4600       4610       4620 
TAGGCCTAGA AATAAACATG CTAGCTTTTA TTCCAGTTCT AACCAAAAAA ATAAACCCTC 
ATCCGGATCT TTATTTGTAC GATCGAAAAT AAGGTCAAGA TTGGTTTTTT TATTTGGGAG 
                                                                  
      4630       4640       4650       4660       4670       4680 
GTTCCACAGA AGCTGCCATC AAGTATTTCC TCACGCAAGC AACCGCATCC ATAATCCTTC 
CAAGGTGTCT TCGACGGTAG TTCATAAAGG AGTGCGTTCG TTGGCGTAGG TATTAGGAAG 
                                                                  
      4690       4700       4710       4720       4730       4740 
TAATAGCTAT CCTCTTCAAC AATATACTCT CCGGACAATG AACCATAACC AATACTACCA 
ATTATCGATA GGAGAAGTTG TTATATGAGA GGCCTGTTAC TTGGTATTGG TTATGATGGT 
                                                                  
      4750       4760       4770       4780       4790       4800 
ATCAATACTC ATCATTAATA ATCATAATAG CTATAGCAAT AAAACTAGGA ATAGCCCCCT Back to Top
TAGTTATGAG TAGTAATTAT TAGTATTATC GATATCGTTA TTTTGATCCT TATCGGGGGA 
                                                                  
      4810       4820       4830       4840       4850       4860 
TTCACTTCTG AGTCCCAGAG GTTACCCAAG GCACCCCTCT GACATCCGGC CTGCTTCTTC 
AAGTGAAGAC TCAGGGTCTC CAATGGGTTC CGTGGGGAGA CTGTAGGCCG GACGAAGAAG 
                                                                  
      4870       4880       4890       4900       4910       4920 
TCACATGACA AAAACTAGCC CCCATCTCAA TCATATACCA AATCTCTCCC TCACTAAACG 
AGTGTACTGT TTTTGATCGG GGGTAGAGTT AGTATATGGT TTAGAGAGGG AGTGATTTGC 
                                                                  
      4930       4940       4950       4960       4970       4980 
TAAGCCTTCT CCTCACTCTC TCAATCTTAT CCATCATAGC AGGCAGTTGA GGTGGATTAA 
ATTCGGAAGA GGAGTGAGAG AGTTAGAATA GGTAGTATCG TCCGTCAACT CCACCTAATT 
                                                                  
      4990       5000       5010       5020       5030       5040 
ACCAAACCCA GCTACGCAAA ATCTTAGCAT ACTCCTCAAT TACCCACATA GGATGAATAA   Back to Top
TGGTTTGGGT CGATGCGTTT TAGAATCGTA TGAGGAGTTA ATGGGTGTAT CCTACTTATT 
                                                                  
      5050       5060       5070       5080       5090       5100 
TAGCAGTTCT ACCGTACAAC CCTAACATAA CCATTCTTAA TTTAACTATT TATATTATCC 
ATCGTCAAGA TGGCATGTTG GGATTGTATT GGTAAGAATT AAATTGATAA ATATAATAGG 
                                                                  
      5110       5120       5130       5140       5150       5160 
TAACTACTAC CGCATTCCTA CTACTCAACT TAAACTCCAG CACCACGACC CTACTACTAT 
ATTGATGATG GCGTAAGGAT GATGAGTTGA ATTTGAGGTC GTGGTGCTGG GATGATGATA 
                                                                  
      5170       5180       5190       5200       5210       5220 
CTCGCACCTG AAACAAGCTA ACATGACTAA CACCCTTAAT TCCATCCACC CTCCTCTCCC 
GAGCGTGGAC TTTGTTCGAT TGTACTGATT GTGGGAATTA AGGTAGGTGG GAGGAGAGGG 
                                                                  
      5230       5240       5250       5260       5270       5280 
TAGGAGGCCT GCCCCCGCTA ACCGGCTTTT TGCCCAAATG GGCCATTATC GAAGAATTCA 
ATCCTCCGGA CGGGGGCGAT TGGCCGAAAA ACGGGTTTAC CCGGTAATAG CTTCTTAAGT 
                                                                  
      5290       5300       5310       5320       5330       5340 
CAAAAAACAA TAGCCTCATC ATCCCCACCA TCATAGCCAC CATCACCCTC CTTAACCTCT 
GTTTTTTGTT ATCGGAGTAG TAGGGGTGGT AGTATCGGTG GTAGTGGGAG GAATTGGAGA 
                                                                  
      5350       5360       5370       5380       5390       5400 
ACTTCTACCT ACGCCTAATC TACTCCACCT CAATCACACT ACTCCCCATA TCTAACAACG 
TGAAGATGGA TGCGGATTAG ATGAGGTGGA GTTAGTGTGA TGAGGGGTAT AGATTGTTGC 
                                                                  
      5410       5420       5430       5440       5450       5460 
TAAAAATAAA ATGACAGTTT GAACATACAA AACCCACCCC ATTCCTCCCC ACACTCATCG 
ATTTTTATTT TACTGTCAAA CTTGTATGTT TTGGGTGGGG TAAGGAGGGG TGTGAGTAGC 
                                                                  
      5470       5480       5490       5500       5510       5520 
CCCTTACCAC GCTACTCCTA CCTATCTCCC CTTTTATACT AATAATCTTA TAGAAATTTA 
GGGAATGGTG CGATGAGGAT GGATAGAGGG GAAAATATGA TTATTAGAAT ATCTTTAAAT 
                                                                  
      5530       5540       5550       5560       5570       5580 
GGTTAAATAC AGACCAAGAG CCTTCAAAGC CCTCAGTAAG TTGCAATACT TAATTTCTGT 
CCAATTTATG TCTGGTTCTC GGAAGTTTCG GGAGTCATTC AACGTTATGA ATTAAAGACA 
                                                                  
      5590       5600       5610       5620       5630       5640 
AACAGCTAAG GACTGCAAAA CCCCACTCTG CATCAACTGA ACGCAAATCA GCCACTTTAA 
TTGTCGATTC CTGACGTTTT GGGGTGAGAC GTAGTTGACT TGCGTTTAGT CGGTGAAATT 
                                                                  
      5650       5660       5670       5680       5690       5700 
TTAAGCTAAG CCCTTACTAG ACCAATGGGA CTTAAACCCA CAAACACTTA GTTAACAGCT 
AATTCGATTC GGGAATGATC TGGTTACCCT GAATTTGGGT GTTTGTGAAT CAATTGTCGA 
                                                                  
      5710       5720       5730       5740       5750       5760 
AAGCACCCTA ATCAACTGGC TTCAATCTAC TTCTCCCGCC GCCGGGAAAA AAGGCGGGAG 
TTCGTGGGAT TAGTTGACCG AAGTTAGATG AAGAGGGCGG CGGCCCTTTT TTCCGCCCTC 
                                                                  
      5770       5780       5790       5800       5810       5820 
AAGCCCCGGC AGGTTTGAAG CTGCTTCTTC GAATTTGCAA TTCAATATGA AAATCACCTC 
TTCGGGGCCG TCCAAACTTC GACGAAGAAG CTTAAACGTT AAGTTATACT TTTAGTGGAG 
                                                                  
      5830       5840       5850       5860       5870       5880 
GGAGCTGGTA AAAAGAGGCC TAACCCCTGT CTTTAGATTT ACAGTCCAAT GCTTCACTCA 
CCTCGACCAT TTTTCTCCGG ATTGGGGACA GAAATCTAAA TGTCAGGTTA CGAAGTGAGT 
                                                                  
      5890       5900       5910       5920       5930       5940 
GCCATTTTAC CTCACCCCCA CTGATGTTCG CCGACCGTTG ACTATTCTCT ACAAACCACA 
CGGTAAAATG GAGTGGGGGT GACTACAAGC GGCTGGCAAC TGATAAGAGA TGTTTGGTGT 
                                                                  
      5950       5960       5970       5980       5990       6000 
AAGACATTGG AACACTATAC CTATTATTCG GCGCATGAGC TGGAGTCCTA GGCACAGCTC 
TTCTGTAACC TTGTGATATG GATAATAAGC CGCGTACTCG ACCTCAGGAT CCGTGTCGAG 
                                                                  
      6010       6020       6030       6040       6050       6060 
TAAGCCTCCT TATTCGAGCC GAGCTGGGCC AGCCAGGCAA CCTTCTAGGT AACGACCACA 
ATTCGGAGGA ATAAGCTCGG CTCGACCCGG TCGGTCCGTT GGAAGATCCA TTGCTGGTGT 
                                                                  
      6070       6080       6090       6100       6110       6120 
TCTACAACGT TATCGTCACA GCCCATGCAT TTGTAATAAT CTTCTTCATA GTAATACCCA 
AGATGTTGCA ATAGCAGTGT CGGGTACGTA AACATTATTA GAAGAAGTAT CATTATGGGT 
                                                                  
      6130       6140       6150       6160       6170       6180 
TCATAATCGG AGGCTTTGGC AACTGACTAG TTCCCCTAAT AATCGGTGCC CCCGATATGG 
AGTATTAGCC TCCGAAACCG TTGACTGATC AAGGGGATTA TTAGCCACGG GGGCTATACC 
                                                                  
      6190       6200       6210       6220       6230       6240 
CGTTTCCCCG CATAAACAAC ATAAGCTTCT GACTCTTACC TCCCTCTCTC CTACTCCTGC 
GCAAAGGGGC GTATTTGTTG TATTCGAAGA CTGAGAATGG AGGGAGAGAG GATGAGGACG 
                                                                  
      6250       6260       6270       6280       6290       6300 
TCGCATCTGC TATAGTGGAG GCCGGAGCAG GAACAGGTTG AACAGTCTAC CCTCCCTTAG 
AGCGTAGACG ATATCACCTC CGGCCTCGTC CTTGTCCAAC TTGTCAGATG GGAGGGAATC 
                                                                  
      6310       6320       6330       6340       6350       6360 
CAGGGAACTA CTCCCACCCT GGAGCCTCCG TAGACCTAAC CATCTTCTCC TTACACCTAG 
GTCCCTTGAT GAGGGTGGGA CCTCGGAGGC ATCTGGATTG GTAGAAGAGG AATGTGGATC 
                                                                  
      6370       6380       6390       6400       6410       6420 
CAGGTGTCTC CTCTATCTTA GGGGCCATCA ATTTCATCAC AACAATTATC AATATAAAAC 
GTCCACAGAG GAGATAGAAT CCCCGGTAGT TAAAGTAGTG TTGTTAATAG TTATATTTTG 
                                                                  
      6430       6440       6450       6460       6470       6480 
CCCCTGCCAT AACCCAATAC CAAACGCCCC TCTTCGTCTG ATCCGTCCTA ATCACAGCAG 
GGGGACGGTA TTGGGTTATG GTTTGCGGGG AGAAGCAGAC TAGGCAGGAT TAGTGTCGTC 
                                                                  
      6490       6500       6510       6520       6530       6540 
TCCTACTTCT CCTATCTCTC CCAGTCCTAG CTGCTGGCAT CACTATACTA CTAACAGACC 
AGGATGAAGA GGATAGAGAG GGTCAGGATC GACGACCGTA GTGATATGAT GATTGTCTGG 
                                                                  
      6550       6560       6570       6580       6590       6600 
GCAACCTCAA CACCACCTTC TTCGACCCCG CCGGAGGAGG AGACCCCATT CTATACCAAC 
CGTTGGAGTT GTGGTGGAAG AAGCTGGGGC GGCCTCCTCC TCTGGGGTAA GATATGGTTG 
                                                                  
      6610       6620       6630       6640       6650       6660 
ACCTATTCTG ATTTTTCGGT CACCCTGAAG TTTATATTCT TATCCTACCA GGCTTCGGAA 
TGGATAAGAC TAAAAAGCCA GTGGGACTTC AAATATAAGA ATAGGATGGT CCGAAGCCTT 
                                                                  
      6670       6680       6690       6700       6710       6720 
TAATCTCCCA TATTGTAACT TACTACTCCG GAAAAAAAGA ACCATTTGGA TACATAGGTA 
ATTAGAGGGT ATAACATTGA ATGATGAGGC CTTTTTTTCT TGGTAAACCT ATGTATCCAT 
                                                                  
      6730       6740       6750       6760       6770       6780 
TGGTCTGAGC TATGATATCA ATTGGCTTCC TAGGGTTTAT CGTGTGAGCA CACCATATAT 
ACCAGACTCG ATACTATAGT TAACCGAAGG ATCCCAAATA GCACACTCGT GTGGTATATA 
                                                                  
      6790       6800       6810       6820       6830       6840 
TTACAGTAGG AATAGACGTA GACACACGAG CATATTTCAC CTCCGCTACC ATAATCATCG 
AATGTCATCC TTATCTGCAT CTGTGTGCTC GTATAAAGTG GAGGCGATGG TATTAGTAGC 
                                                                  
      6850       6860       6870       6880       6890       6900 
CTATCCCCAC CGGCGTCAAA GTATTTAGCT GACTCGCCAC ACTCCACGGA AGCAATATGA 
GATAGGGGTG GCCGCAGTTT CATAAATCGA CTGAGCGGTG TGAGGTGCCT TCGTTATACT 
                                                                  
      6910       6920       6930       6940       6950       6960 
AATGATCTGC TGCAGTGCTC TGAGCCCTAG GATTCATCTT TCTTTTCACC GTAGGTGGCC 
TTACTAGACG ACGTCACGAG ACTCGGGATC CTAAGTAGAA AGAAAAGTGG CATCCACCGG 
                                                                  
      6970       6980       6990       7000       7010       7020 
TGACTGGCAT TGTATTAGCA AACTCATCAC TAGACATCGT ACTACACGAC ACGTACTACG 
ACTGACCGTA ACATAATCGT TTGAGTAGTG ATCTGTAGCA TGATGTGCTG TGCATGATGC 
                                                                  
      7030       7040       7050       7060       7070       7080 
TTGTAGCCCA CTTCCACTAT GTCCTATCAA TAGGAGCTGT ATTTGCCATC ATAGGAGGCT 
AACATCGGGT GAAGGTGATA CAGGATAGTT ATCCTCGACA TAAACGGTAG TATCCTCCGA 
                                                                  
      7090       7100       7110       7120       7130       7140 
TCATTCACTG ATTTCCCCTA TTCTCAGGCT ACACCCTAGA CCAAACCTAC GCCAAAATCC 
AGTAAGTGAC TAAAGGGGAT AAGAGTCCGA TGTGGGATCT GGTTTGGATG CGGTTTTAGG 
                                                                  
      7150       7160       7170       7180       7190       7200 
ATTTCACTAT CATATTCATC GGCGTAAATC TAACTTTCTT CCCACAACAC TTTCTCGGCC 
TAAAGTGATA GTATAAGTAG CCGCATTTAG ATTGAAAGAA GGGTGTTGTG AAAGAGCCGG 
                                                                  
      7210       7220       7230       7240       7250       7260 
TATCCGGAAT GCCCCGACGT TACTCGGACT ACCCCGATGC ATACACCACA TGAAACATCC 
ATAGGCCTTA CGGGGCTGCA ATGAGCCTGA TGGGGCTACG TATGTGGTGT ACTTTGTAGG 
                                                                  
      7270       7280       7290       7300       7310       7320 
TATCATCTGT AGGCTCATTC ATTTCTCTAA CAGCAGTAAT ATTAATAATT TTCATGATTT 
ATAGTAGACA TCCGAGTAAG TAAAGAGATT GTCGTCATTA TAATTATTAA AAGTACTAAA 
                                                                  
      7330       7340       7350       7360       7370       7380 
GAGAAGCCTT CGCTTCGAAG CGAAAAGTCC TAATAGTAGA AGAACCCTCC ATAAACCTGG 
CTCTTCGGAA GCGAAGCTTC GCTTTTCAGG ATTATCATCT TCTTGGGAGG TATTTGGACC 
                                                                  
      7390       7400       7410       7420       7430       7440 
AGTGACTATA TGGATGCCCC CCACCCTACC ACACATTCGA AGAACCCGTA TACATAAAAT 
TCACTGATAT ACCTACGGGG GGTGGGATGG TGTGTAAGCT TCTTGGGCAT ATGTATTTTA 
                                                                  
      7450       7460       7470       7480       7490       7500 
CTAGACAAAA AAGGAAGGAA TCGAACCCCC CAAAGCTGGT TTCAAGCCAA CCCCATGGCC 
GATCTGTTTT TTCCTTCCTT AGCTTGGGGG GTTTCGACCA AAGTTCGGTT GGGGTACCGG 
                                                                  
      7510       7520       7530       7540       7550       7560 
TCCATGACTT TTTCAAAAAG GTATTAGAAA AACCATTTCA TAACTTTGTC AAAGTTAAAT 
AGGTACTGAA AAAGTTTTTC CATAATCTTT TTGGTAAAGT ATTGAAACAG TTTCAATTTA 
                                                                  
      7570       7580       7590       7600       7610       7620 
TATAGGCTAA ATCCTATATA TCTTAATGGC ACATGCAGCG CAAGTAGGTC TACAAGACGC 
ATATCCGATT TAGGATATAT AGAATTACCG TGTACGTCGC GTTCATCCAG ATGTTCTGCG 
                                                                  
      7630       7640       7650       7660       7670       7680 
TACTTCCCCT ATCATAGAAG AGCTTATCAC CTTTCATGAT CACGCCCTCA TAATCATTTT 
ATGAAGGGGA TAGTATCTTC TCGAATAGTG GAAAGTACTA GTGCGGGAGT ATTAGTAAAA 
                                                                  
      7690       7700       7710       7720       7730       7740 
CCTTATCTGC TTCCTAGTCC TGTATGCCCT TTTCCTAACA CTCACAACAA AACTAACTAA 
GGAATAGACG AAGGATCAGG ACATACGGGA AAAGGATTGT GAGTGTTGTT TTGATTGATT 
                                                                  
      7750       7760       7770       7780       7790       7800 
TACTAACATC TCAGACGCTC AGGAAATAGA AACCGTCTGA ACTATCCTGC CCGCCATCAT 
ATGATTGTAG AGTCTGCGAG TCCTTTATCT TTGGCAGACT TGATAGGACG GGCGGTAGTA 
                                                                  
      7810       7820       7830       7840       7850       7860 
CCTAGTCCTC ATCGCCCTCC CATCCCTACG CATCCTTTAC ATAACAGACG AGGTCAACGA 
GGATCAGGAG TAGCGGGAGG GTAGGGATGC GTAGGAAATG TATTGTCTGC TCCAGTTGCT 
                                                                  
      7870       7880       7890       7900       7910       7920 
TCCCTCCCTT ACCATCAAAT CAATTGGCCA CCAATGGTAC TGAACCTACG AGTACACCGA 
AGGGAGGGAA TGGTAGTTTA GTTAACCGGT GGTTACCATG ACTTGGATGC TCATGTGGCT 
                                                                  
      7930       7940       7950       7960       7970       7980 
CTACGGCGGA CTAATCTTCA ACTCCTACAT ACTTCCCCCA TTATTCCTAG AACCAGGCGA 
GATGCCGCCT GATTAGAAGT TGAGGATGTA TGAAGGGGGT AATAAGGATC TTGGTCCGCT 
                                                                  
      7990       8000       8010       8020       8030       8040 
CCTGCGACTC CTTGACGTTG ACAATCGAGT AGTACTCCCG ATTGAAGCCC CCATTCGTAT 
GGACGCTGAG GAACTGCAAC TGTTAGCTCA TCATGAGGGC TAACTTCGGG GGTAAGCATA 
                                                                  
      8050       8060       8070       8080       8090       8100 
AATAATTACA TCACAAGACG TCTTGCACTC ATGAGCTGTC CCCACATTAG GCTTAAAAAC 
TTATTAATGT AGTGTTCTGC AGAACGTGAG TACTCGACAG GGGTGTAATC CGAATTTTTG 
                                                                  
      8110       8120       8130       8140       8150       8160 
AGATGCAATT CCCGGACGTC TAAACCAAAC CACTTTCACC GCTACACGAC CGGGGGTATA 
TCTACGTTAA GGGCCTGCAG ATTTGGTTTG GTGAAAGTGG CGATGTGCTG GCCCCCATAT 
                                                                  
      8170       8180       8190       8200       8210       8220 
CTACGGTCAA TGCTCTGAAA TCTGTGGAGC AAACCACAGT TTCATGCCCA TCGTCCTAGA 
GATGCCAGTT ACGAGACTTT AGACACCTCG TTTGGTGTCA AAGTACGGGT AGCAGGATCT 
                                                                  
      8230       8240       8250       8260       8270       8280 
ATTAATTCCC CTAAAAATCT TTGAAATAGG GCCCGTATTT ACCCTATAGC ACCCCCTCTA 
TAATTAAGGG GATTTTTAGA AACTTTATCC CGGGCATAAA TGGGATATCG TGGGGGAGAT 
                                                                  
      8290       8300       8310       8320       8330       8340 
CCCCCTCTAG AGCCCACTGT AAAGCTAACT TAGCATTAAC CTTTTAAGTT AAAGATTAAG 
GGGGGAGATC TCGGGTGACA TTTCGATTGA ATCGTAATTG GAAAATTCAA TTTCTAATTC 
                                                                  
      8350       8360       8370       8380       8390       8400 
AGAACCAACA CCTCTTTACA GTGAAATGCC CCAACTAAAT ACTACCGTAT GGCCCACCAT 
TCTTGGTTGT GGAGAAATGT CACTTTACGG GGTTGATTTA TGATGGCATA CCGGGTGGTA 
                                                                  
      8410       8420       8430       8440       8450       8460 
AATTACCCCC ATACTCCTTA CACTATTCCT CATCACCCAA CTAAAAATAT TAAACACAAA 
TTAATGGGGG TATGAGGAAT GTGATAAGGA GTAGTGGGTT GATTTTTATA ATTTGTGTTT 
                                                                  
      8470       8480       8490       8500       8510       8520 
CTACCACCTA CCTCCCTCAC CAAAGCCCAT AAAAATAAAA AATTATAACA AACCCTGAGA 
GATGGTGGAT GGAGGGAGTG GTTTCGGGTA TTTTTATTTT TTAATATTGT TTGGGACTCT 
                                                                  
      8530       8540       8550       8560       8570       8580 
ACCAAAATGA ACGAAAATCT GTTCGCTTCA TTCATTGCCC CCACAATCCT AGGCCTACCC 
TGGTTTTACT TGCTTTTAGA CAAGCGAAGT AAGTAACGGG GGTGTTAGGA TCCGGATGGG 
                                                                  
      8590       8600       8610       8620       8630       8640 
GCCGCAGTAC TGATCATTCT ATTTCCCCCT CTATTGATCC CCACCTCCAA ATATCTCATC 
CGGCGTCATG ACTAGTAAGA TAAAGGGGGA GATAACTAGG GGTGGAGGTT TATAGAGTAG 
                                                                  
      8650       8660       8670       8680       8690       8700 
AACAACCGAC TAATCACCAC CCAACAATGA CTAATCAAAC TAACCTCAAA ACAAATGATA 
TTGTTGGCTG ATTAGTGGTG GGTTGTTACT GATTAGTTTG ATTGGAGTTT TGTTTACTAT 
                                                                  
      8710       8720       8730       8740       8750       8760 
ACCATACACA ACACTAAAGG ACGAACCTGA TCTCTTATAC TAGTATCCTT AATCATTTTT 
TGGTATGTGT TGTGATTTCC TGCTTGGACT AGAGAATATG ATCATAGGAA TTAGTAAAAA 
                                                                  
      8770       8780       8790       8800       8810       8820 
ATTGCCACAA CTAACCTCCT CGGACTCCTG CCTCACTCAT TTACACCAAC CACCCAACTA 
TAACGGTGTT GATTGGAGGA GCCTGAGGAC GGAGTGAGTA AATGTGGTTG GTGGGTTGAT 
                                                                  
      8830       8840       8850       8860       8870       8880 
TCTATAAACC TAGCCATGGC CATCCCCTTA TGAGCGGGCA CAGTGATTAT AGGCTTTCGC   Back to Top
AGATATTTGG ATCGGTACCG GTAGGGGAAT ACTCGCCCGT GTCACTAATA TCCGAAAGCG 
                                                                  
      8890       8900       8910       8920       8930       8940 
TCTAAGATTA AAAATGCCCT AGCCCACTTC TTACCACAAG GCACACCTAC ACCCCTTATC 
AGATTCTAAT TTTTACGGGA TCGGGTGAAG AATGGTGTTC CGTGTGGATG TGGGGAATAG 
                                                                  
      8950       8960       8970       8980       8990       9000 
CCCATACTAG TTATTATCGA AACCATCAGC CTACTCATTC AACCAATAGC CCTGGCCGTA 
GGGTATGATC AATAATAGCT TTGGTAGTCG GATGAGTAAG TTGGTTATCG GGACCGGCAT 
                                                                  
      9010       9020       9030       9040       9050       9060 
CGCCTAACCG CTAACATTAC TGCAGGCCAC CTACTCATGC ACCTAATTGG AAGCGCCACC 
GCGGATTGGC GATTGTAATG ACGTCCGGTG GATGAGTACG TGGATTAACC TTCGCGGTGG 
                                                                  
      9070       9080       9090       9100       9110       9120 
CTAGCAATAT CAACCATTAA CCTTCCCTCT ACACTTATCA TCTTCACAAT TCTAATTCTA 
GATCGTTATA GTTGGTAATT GGAAGGGAGA TGTGAATAGT AGAAGTGTTA AGATTAAGAT 
                                                                  
      9130       9140       9150       9160       9170       9180 
CTGACTATCC TAGAAATCGC TGTCGCCTTA ATCCAAGCCT ACGTTTTCAC ACTTCTAGTA 
GACTGATAGG ATCTTTAGCG ACAGCGGAAT TAGGTTCGGA TGCAAAAGTG TGAAGATCAT 
                                                                  
      9190       9200       9210       9220       9230       9240 
AGCCTCTACC TGCACGACAA CACATAATGA CCCACCAATC ACATGCCTAT CATATAGTAA 
TCGGAGATGG ACGTGCTGTT GTGTATTACT GGGTGGTTAG TGTACGGATA GTATATCATT 
                                                                  
      9250       9260       9270       9280       9290       9300 
AACCCAGCCC ATGACCCCTA ACAGGGGCCC TCTCAGCCCT CCTAATGACC TCCGGCCTAG 
TTGGGTCGGG TACTGGGGAT TGTCCCCGGG AGAGTCGGGA GGATTACTGG AGGCCGGATC 
                                                                  
      9310       9320       9330       9340       9350       9360 
CCATGTGATT TCACTTCCAC TCCATAACGC TCCTCATACT AGGCCTACTA ACCAACACAC 
GGTACACTAA AGTGAAGGTG AGGTATTGCG AGGAGTATGA TCCGGATGAT TGGTTGTGTG 
                                                                  
      9370       9380       9390       9400       9410       9420 
TAACCATATA CCAATGATGG CGCGATGTAA CACGAGAAAG CACATACCAA GGCCACCACA 
ATTGGTATAT GGTTACTACC GCGCTACATT GTGCTCTTTC GTGTATGGTT CCGGTGGTGT 
                                                                  
      9430       9440       9450       9460       9470       9480 
CACCACCTGT CCAAAAAGGC CTTCGATACG GGATAATCCT ATTTATTACC TCAGAAGTTT 
GTGGTGGACA GGTTTTTCCG GAAGCTATGC CCTATTAGGA TAAATAATGG AGTCTTCAAA 
                                                                  
      9490       9500       9510       9520       9530       9540 
TTTTCTTCGC AGGATTTTTC TGAGCCTTTT ACCACTCCAG CCTAGCCCCT ACCCCCCAAT 
AAAAGAAGCG TCCTAAAAAG ACTCGGAAAA TGGTGAGGTC GGATCGGGGA TGGGGGGTTA 
                                                                  
      9550       9560       9570       9580       9590       9600 
TAGGAGGGCA CTGGCCCCCA ACAGGCATCA CCCCGCTAAA TCCCCTAGAA GTCCCACTCC   Back to Top
ATCCTCCCGT GACCGGGGGT TGTCCGTAGT GGGGCGATTT AGGGGATCTT CAGGGTGAGG 
                                                                  
      9610       9620       9630       9640       9650       9660 
TAAACACATC CGTATTACTC GCATCAGGAG TATCAATCAC CTGAGCTCAC CATAGTCTAA 
ATTTGTGTAG GCATAATGAG CGTAGTCCTC ATAGTTAGTG GACTCGAGTG GTATCAGATT 
                                                                  
      9670       9680       9690       9700       9710       9720 
TAGAAAACAA CCGAAACCAA ATAATTCAAG CACTGCTTAT TACAATTTTA CTGGGTCTCT 
ATCTTTTGTT GGCTTTGGTT TATTAAGTTC GTGACGAATA ATGTTAAAAT GACCCAGAGA 
                                                                  
      9730       9740       9750       9760       9770       9780 
ATTTTACCCT CCTACAAGCC TCAGAGTACT TCGAGTCTCC CTTCACCATT TCCGACGGCA 
TAAAATGGGA GGATGTTCGG AGTCTCATGA AGCTCAGAGG GAAGTGGTAA AGGCTGCCGT 
                                                                  
      9790       9800       9810       9820       9830       9840 
TCTACGGCTC AACATTTTTT GTAGCCACAG GCTTCCACGG ACTTCACGTC ATTATTGGCT 
AGATGCCGAG TTGTAAAAAA CATCGGTGTC CGAAGGTGCC TGAAGTGCAG TAATAACCGA 
                                                                  
      9850       9860       9870       9880       9890       9900 
CAACTTTCCT CACTATCTGC TTCATCCGCC AACTAATATT TCACTTTACA TCCAAACATC 
GTTGAAAGGA GTGATAGACG AAGTAGGCGG TTGATTATAA AGTGAAATGT AGGTTTGTAG 
                                                                  
      9910       9920       9930       9940       9950       9960 
ACTTTGGCTT CGAAGCCGCC GCCTGATACT GGCATTTTGT AGATGTGGTT TGACTATTTC 
TGAAACCGAA GCTTCGGCGG CGGACTATGA CCGTAAAACA TCTACACCAA ACTGATAAAG 
                                                                  
      9970       9980       9990      10000      10010      10020 
TGTATGTCTC CATCTATTGA TGAGGGTCTT ACTCTTTTAG TATAAATAGT ACCGTTAACT 
ACATACAGAG GTAGATAACT ACTCCCAGAA TGAGAAAATC ATATTTATCA TGGCAATTGA 
                                                                  
     10030      10040      10050      10060      10070      10080 
TCCAATTAAC TAGTTTTGAC AACATTCAAA AAAGAGTAAT AAACTTCGCC TTAATTTTAA 
AGGTTAATTG ATCAAAACTG TTGTAAGTTT TTTCTCATTA TTTGAAGCGG AATTAAAATT 
                                                                  
     10090      10100      10110      10120      10130      10140 
TAATCAACAC CCTCCTAGCC TTACTACTAA TAATTATTAC ATTTTGACTA CCACAACTCA 
ATTAGTTGTG GGAGGATCGG AATGATGATT ATTAATAATG TAAAACTGAT GGTGTTGAGT 
                                                                  
     10150      10160      10170      10180      10190      10200 
ACGGCTACAT AGAAAAATCC ACCCCTTACG AGTGCGGCTT CGACCCTATA TCCCCCGCCC 
TGCCGATGTA TCTTTTTAGG TGGGGAATGC TCACGCCGAA GCTGGGATAT AGGGGGCGGG 
                                                                  
     10210      10220      10230      10240      10250      10260 
GCGTCCCTTT CTCCATAAAA TTCTTCTTAG TAGCTATTAC CTTCTTATTA TTTGATCTAG 
CGCAGGGAAA GAGGTATTTT AAGAAGAATC ATCGATAATG GAAGAATAAT AAACTAGATC 
                                                                  
     10270      10280      10290      10300      10310      10320 
AAATTGCCCT CCTTTTACCC CTACCATGAG CCCTACAAAC AACTAACCTG CCACTAATAG 
TTTAACGGGA GGAAAATGGG GATGGTACTC GGGATGTTTG TTGATTGGAC GGTGATTATC 
                                                                  
     10330      10340      10350      10360      10370      10380 
TTATGTCATC CCTCTTATTA ATCATCATCC TAGCCCTAAG TCTGGCCTAT GAGTGACTAC 
AATACAGTAG GGAGAATAAT TAGTAGTAGG ATCGGGATTC AGACCGGATA CTCACTGATG 
                                                                  
     10390      10400      10410      10420      10430      10440 
AAAAAGGATT AGACTGAACC GAATTGGTAT ATAGTTTAAA CAAAACGAAT GATTTCGACT 
TTTTTCCTAA TCTGACTTGG CTTAACCATA TATCAAATTT GTTTTGCTTA CTAAAGCTGA 
                                                                  
     10450      10460      10470      10480      10490      10500 
CATTAAATTA TGATAATCAT ATTTACCAAA TGCCCCTCAT TTACATAAAT ATTATACTAG 
GTAATTTAAT ACTATTAGTA TAAATGGTTT ACGGGGAGTA AATGTATTTA TAATATGATC 
                                                                  
     10510      10520      10530      10540      10550      10560 
CATTTACCAT CTCACTTCTA GGAATACTAG TATATCGCTC ACACCTCATA TCCTCCCTAC 
GTAAATGGTA GAGTGAAGAT CCTTATGATC ATATAGCGAG TGTGGAGTAT AGGAGGGATG 
                                                                  
     10570      10580      10590      10600      10610      10620 
TATGCCTAGA AGGAATAATA CTATCGCTGT TCATTATAGC TACTCTCATA ACCCTCAACA 
ATACGGATCT TCCTTATTAT GATAGCGACA AGTAATATCG ATGAGAGTAT TGGGAGTTGT 
                                                                  
     10630      10640      10650      10660      10670      10680 
CCCACTCCCT CTTAGCCAAT ATTGTGCCTA TTGCCATACT AGTCTTTGCC GCCTGCGAAG 
GGGTGAGGGA GAATCGGTTA TAACACGGAT AACGGTATGA TCAGAAACGG CGGACGCTTC 
                                                                  
     10690      10700      10710      10720      10730      10740 
CAGCGGTGGG CCTAGCCCTA CTAGTCTCAA TCTCCAACAC ATATGGCCTA GACTACGTAC 
GTCGCCACCC GGATCGGGAT GATCAGAGTT AGAGGTTGTG TATACCGGAT CTGATGCATG 
                                                                  
     10750      10760      10770      10780      10790      10800 
ATAACCTAAA CCTACTCCAA TGCTAAAACT AATCGTCCCA ACAATTATAT TACTACCACT 
TATTGGATTT GGATGAGGTT ACGATTTTGA TTAGCAGGGT TGTTAATATA ATGATGGTGA 
                                                                  
     10810      10820      10830      10840      10850      10860 
GACATGACTT TCCAAAAAAC ACATAATTTG AATCAACACA ACCACCCACA GCCTAATTAT 
CTGTACTGAA AGGTTTTTTG TGTATTAAAC TTAGTTGTGT TGGTGGGTGT CGGATTAATA 
                                                                  
     10870      10880      10890      10900      10910      10920 
TAGCATCATC CCTCTACTAT TTTTTAACCA AATCAACAAC AACCTATTTA GCTGTTCCCC 
ATCGTAGTAG GGAGATGATA AAAAATTGGT TTAGTTGTTG TTGGATAAAT CGACAAGGGG 
                                                                  
     10930      10940      10950      10960      10970      10980 
AACCTTTTCC TCCGACCCCC TAACAACCCC CCTCCTAATA CTAACTACCT GACTCCTACC 
TTGGAAAAGG AGGCTGGGGG ATTGTTGGGG GGAGGATTAT GATTGATGGA CTGAGGATGG 
                                                                  
     10990      11000      11010      11020      11030      11040 
CCTCACAATC ATGGCAAGCC AACGCCACTT ATCCAGTGAA CCACTATCAC GAAAAAAACT 
GGAGTGTTAG TACCGTTCGG TTGCGGTGAA TAGGTCACTT GGTGATAGTG CTTTTTTTGA 
                                                                  
     11050      11060      11070      11080      11090      11100 
CTACCTCTCT ATACTAATCT CCCTACAAAT CTCCTTAATT ATAACATTCA CAGCCACAGA 
GATGGAGAGA TATGATTAGA GGGATGTTTA GAGGAATTAA TATTGTAAGT GTCGGTGTCT 
                                                                  
     11110      11120      11130      11140      11150      11160 
ACTAATCATA TTTTATATCT TCTTCGAAAC CACACTTATC CCCACCTTGG CTATCATCAC 
TGATTAGTAT AAAATATAGA AGAAGCTTTG GTGTGAATAG GGGTGGAACC GATAGTAGTG 
                                                                  
     11170      11180      11190      11200      11210      11220 
CCGATGAGGC AACCAGCCAG AACGCCTGAA CGCAGGCACA TACTTCCTAT TCTACACCCT 
GGCTACTCCG TTGGTCGGTC TTGCGGACTT GCGTCCGTGT ATGAAGGATA AGATGTGGGA 
                                                                  
     11230      11240      11250      11260      11270      11280 
AGTAGGCTCC CTTCCCCTAC TCATCGCACT AATTTACACT CACAACACCC TAGGCTCACT 
TCATCCGAGG GAAGGGGATG AGTAGCGTGA TTAAATGTGA GTGTTGTGGG ATCCGAGTGA 
                                                                  
     11290      11300      11310      11320      11330      11340 
AAACATTCTA CTACTCACTC TCACTGCCCA AGAACTATCA AACTCCTGAG CCAACAACTT   Back to Top
TTTGTAAGAT GATGAGTGAG AGTGACGGGT TCTTGATAGT TTGAGGACTC GGTTGTTGAA 
                                                                  
     11350      11360      11370      11380      11390      11400 
AATATGACTA GCTTACACAA TAGCTTTTAT AGTAAAGATA CCTCTTTACG GACTCCACTT 
TTATACTGAT CGAATGTGTT ATCGAAAATA TCATTTCTAT GGAGAAATGC CTGAGGTGAA 
                                                                  
     11410      11420      11430      11440      11450      11460 
ATGACTCCCT AAAGCCCATG TCGAAGCCCC CATCGCTGGG TCAATAGTAC TTGCCGCAGT 
TACTGAGGGA TTTCGGGTAC AGCTTCGGGG GTAGCGACCC AGTTATCATG AACGGCGTCA 
                                                                  
     11470      11480      11490      11500      11510      11520 
ACTCTTAAAA CTAGGCGGCT ATGGTATAAT ACGCCTCACA CTCATTCTCA ACCCCCTGAC 
TGAGAATTTT GATCCGCCGA TACCATATTA TGCGGAGTGT GAGTAAGAGT TGGGGGACTG 
                                                                  
     11530      11540      11550      11560      11570      11580 
AAAACACATA GCCTACCCCT TCCTTGTACT ATCCCTATGA GGCATAATTA TAACAAGCTC 
TTTTGTGTAT CGGATGGGGA AGGAACATGA TAGGGATACT CCGTATTAAT ATTGTTCGAG 
                                                                  
     11590      11600      11610      11620      11630      11640 
CATCTGCCTA CGACAAACAG ACCTAAAATC GCTCATTGCA TACTCTTCAA TCAGCCACAT 
GTAGACGGAT GCTGTTTGTC TGGATTTTAG CGAGTAACGT ATGAGAAGTT AGTCGGTGTA 
                                                                  
     11650      11660      11670      11680      11690      11700 
AGCCCTCGTA GTAACAGCCA TTCTCATCCA AACCCCCTGA AGCTTCACCG GCGCAGTCAT 
TCGGGAGCAT CATTGTCGGT AAGAGTAGGT TTGGGGGACT TCGAAGTGGC CGCGTCAGTA 
                                                                  
     11710      11720      11730      11740      11750      11760 
TCTCATAATC GCCCACGGGC TTACATCCTC ATTACTATTC TGCCTAGCAA ACTCAAACTA 
AGAGTATTAG CGGGTGCCCG AATGTAGGAG TAATGATAAG ACGGATCGTT TGAGTTTGAT 
                                                                  
     11770      11780      11790      11800      11810      11820 
CGAACGCACT CACAGTCGCA TCATAATCCT CTCTCAAGGA CTTCAAACTC TACTCCCACT 
GCTTGCGTGA GTGTCAGCGT AGTATTAGGA GAGAGTTCCT GAAGTTTGAG ATGAGGGTGA 
                                                                  
     11830      11840      11850      11860      11870      11880 
AATAGCTTTT TGATGACTTC TAGCAAGCCT CGCTAACCTC GCCTTACCCC CCACTATTAA 
TTATCGAAAA ACTACTGAAG ATCGTTCGGA GCGATTGGAG CGGAATGGGG GGTGATAATT 
                                                                  
     11890      11900      11910      11920      11930      11940 
CCTACTGGGA GAACTCTCTG TGCTAGTAAC CACGTTCTCC TGATCAAATA TCACTCTCCT 
GGATGACCCT CTTGAGAGAC ACGATCATTG GTGCAAGAGG ACTAGTTTAT AGTGAGAGGA 
                                                                  
     11950      11960      11970      11980      11990      12000 
ACTTACAGGA CTCAACATAC TAGTCACAGC CCTATACTCC CTCTACATAT TTACCACAAC 
TGAATGTCCT GAGTTGTATG ATCAGTGTCG GGATATGAGG GAGATGTATA AATGGTGTTG 
                                                                  
     12010      12020      12030      12040      12050      12060 
ACAATGGGGC TCACTCACCC ACCACATTAA CAACATAAAA CCCTCATTCA CACGAGAAAA 
TGTTACCCCG AGTGAGTGGG TGGTGTAATT GTTGTATTTT GGGAGTAAGT GTGCTCTTTT 
                                                                  
     12070      12080      12090      12100      12110      12120 
CACCCTCATG TTCATACACC TATCCCCCAT TCTCCTCCTA TCCCTCAACC CCGACATCAT 
GTGGGAGTAC AAGTATGTGG ATAGGGGGTA AGAGGAGGAT AGGGAGTTGG GGCTGTAGTA 
                                                                  
     12130      12140      12150      12160      12170      12180 
TACCGGGTTT TCCTCTTGTA AATATAGTTT AACCAAAACA TCAGATTGTG AATCTGACAA 
ATGGCCCAAA AGGAGAACAT TTATATCAAA TTGGTTTTGT AGTCTAACAC TTAGACTGTT 
                                                                  
     12190      12200      12210      12220      12230      12240 
CAGAGGCTTA CGACCCCTTA TTTACCGAGA AAGCTCACAA GAACTGCTAA CTCATGCCCC 
GTCTCCGAAT GCTGGGGAAT AAATGGCTCT TTCGAGTGTT CTTGACGATT GAGTACGGGG 
                                                                  
     12250      12260      12270      12280      12290      12300 
CATGTCTAAC AACATGGCTT TCTCAACTTT TAAAGGATAA CAGCTATCCA TTGGTCTTAG 
GTACAGATTG TTGTACCGAA AGAGTTGAAA ATTTCCTATT GTCGATAGGT AACCAGAATC 
                                                                  
     12310      12320      12330      12340      12350      12360 
GCCCCAAAAA TTTTGGTGCA ACTCCAAATA AAAGTAATAA CCATGCACAC TACTATAACC 
CGGGGTTTTT AAAACCACGT TGAGGTTTAT TTTCATTATT GGTACGTGTG ATGATATTGG 
                                                                  
     12370      12380      12390      12400      12410      12420 
ACCCTAACCC TGACTTCCCT AATTCCCCCC ATCCTTACCA CCCTCGTTAA CCCTAACAAA 
TGGGATTGGG ACTGAAGGGA TTAAGGGGGG TAGGAATGGT GGGAGCAATT GGGATTGTTT 
                                                                  
     12430      12440      12450      12460      12470      12480 
AAAAACTCAT ACCCCCATTA TGTAAAATCC ATTGTCGCAT CCACCTTTAT TATCAGTCTC 
TTTTTGAGTA TGGGGGTAAT ACATTTTAGG TAACAGCGTA GGTGGAAATA ATAGTCAGAG 
                                                                  
     12490      12500      12510      12520      12530      12540 
TTCCCCACAA CAATATTCAT GTGCCTAGAC CAAGAAGTTA TTATCTCGAA CTGACACTGA 
AAGGGGTGTT GTTATAAGTA CACGGATCTG GTTCTTCAAT AATAGAGCTT GACTGTGACT 
                                                                  
     12550      12560      12570      12580      12590      12600 
GCCACAACCC AAACAACCCA GCTCTCCCTA AGCTTCAAAC TAGACTACTT CTCCATAATA 
CGGTGTTGGG TTTGTTGGGT CGAGAGGGAT TCGAAGTTTG ATCTGATGAA GAGGTATTAT 
                                                                  
     12610      12620      12630      12640      12650      12660 
TTCATCCCTG TAGCATTGTT CGTTACATGG TCCATCATAG AATTCTCACT GTGATATATA 
AAGTAGGGAC ATCGTAACAA GCAATGTACC AGGTAGTATC TTAAGAGTGA CACTATATAT 
                                                                  
     12670      12680      12690      12700      12710      12720 
AACTCAGACC CAAACATTAA TCAGTTCTTC AAATATCTAC TCATCTTCCT AATTACCATA 
TTGAGTCTGG GTTTGTAATT AGTCAAGAAG TTTATAGATG AGTAGAAGGA TTAATGGTAT 
                                                                  
     12730      12740      12750      12760      12770      12780 
CTAATCTTAG TTACCGCTAA CAACCTATTC CAACTGTTCA TCGGCTGAGA GGGCGTAGGA 
GATTAGAATC AATGGCGATT GTTGGATAAG GTTGACAAGT AGCCGACTCT CCCGCATCCT 
                                                                  
     12790      12800      12810      12820      12830      12840 
ATTATATCCT TCTTGCTCAT CAGTTGATGA TACGCCCGAG CAGATGCCAA CACAGCAGCC 
TAATATAGGA AGAACGAGTA GTCAACTACT ATGCGGGCTC GTCTACGGTT GTGTCGTCGG 
                                                                  
     12850      12860      12870      12880      12890      12900 
ATTCAAGCAA TCCTATACAA CCGTATCGGC GATATCGGTT TCATCCTCGC CTTAGCATGA 
TAAGTTCGTT AGGATATGTT GGCATAGCCG CTATAGCCAA AGTAGGAGCG GAATCGTACT 
                                                                  
     12910      12920      12930      12940      12950      12960 
TTTATCCTAC ACTCCAACTC ATGAGACCCA CAACAAATAG CCCTTCTAAA CGCTAATCCA 
AAATAGGATG TGAGGTTGAG TACTCTGGGT GTTGTTTATC GGGAAGATTT GCGATTAGGT 
                                                                  
     12970      12980      12990      13000      13010      13020 
AGCCTCACCC CACTACTAGG CCTCCTCCTA GCAGCAGCAG GCAAATCAGC CCAATTAGGT 
TCGGAGTGGG GTGATGATCC GGAGGAGGAT CGTCGTCGTC CGTTTAGTCG GGTTAATCCA 
                                                                  
     13030      13040      13050      13060      13070      13080 
CTCCACCCCT GACTCCCCTC AGCCATAGAA GGCCCCACCC CAGTCTCAGC CCTACTCCAC 
GAGGTGGGGA CTGAGGGGAG TCGGTATCTT CCGGGGTGGG GTCAGAGTCG GGATGAGGTG 
                                                                  
     13090      13100      13110      13120      13130      13140 
TCAAGCACTA TAGTTGTAGC AGGAATCTTC TTACTCATCC GCTTCCACCC CCTAGCAGAA 
AGTTCGTGAT ATCAACATCG TCCTTAGAAG AATGAGTAGG CGAAGGTGGG GGATCGTCTT 
                                                                  
     13150      13160      13170      13180      13190      13200 
AATAGCCCAC TAATCCAAAC TCTAACACTA TGCTTAGGCG CTATCACCAC TCTGTTCGCA 
TTATCGGGTG ATTAGGTTTG AGATTGTGAT ACGAATCCGC GATAGTGGTG AGACAAGCGT 
                                                                  
     13210      13220      13230      13240      13250      13260 
GCAGTCTGCG CCCTTACACA AAATGACATC AAAAAAATCG TAGCCTTCTC CACTTCAAGT 
CGTCAGACGC GGGAATGTGT TTTACTGTAG TTTTTTTAGC ATCGGAAGAG GTGAAGTTCA 
                                                                  
     13270      13280      13290      13300      13310      13320 
CAACTAGGAC TCATAATAGT TACAATCGGC ATCAACCAAC CACACCTAGC ATTCCTGCAC 
GTTGATCCTG AGTATTATCA ATGTTAGCCG TAGTTGGTTG GTGTGGATCG TAAGGACGTG 
                                                                  
     13330      13340      13350      13360      13370      13380 
ATCTGTACCC ACGCCTTCTT CAAAGCCATA CTATTTATGT GCTCCGGGTC CATCATCCAC 
TAGACATGGG TGCGGAAGAA GTTTCGGTAT GATAAATACA CGAGGCCCAG GTAGTAGGTG 
                                                                  
     13390      13400      13410      13420      13430      13440 
AACCTTAACA ATGAACAAGA TATTCGAAAA ATAGGAGGAC TACTCAAAAC CATACCTCTC 
TTGGAATTGT TACTTGTTCT ATAAGCTTTT TATCCTCCTG ATGAGTTTTG GTATGGAGAG 
                                                                  
     13450      13460      13470      13480      13490      13500 
ACTTCAACCT CCCTCACCAT TGGCAGCCTA GCATTAGCAG GAATACCTTT CCTCACAGGT 
TGAAGTTGGA GGGAGTGGTA ACCGTCGGAT CGTAATCGTC CTTATGGAAA GGAGTGTCCA 
                                                                  
     13510      13520      13530      13540      13550      13560 
TTCTACTCCA AAGACCACAT CATCGAAACC GCAAACATAT CATACACAAA CGCCTGAGCC 
AAGATGAGGT TTCTGGTGTA GTAGCTTTGG CGTTTGTATA GTATGTGTTT GCGGACTCGG 
                                                                  
     13570      13580      13590      13600      13610      13620 
CTATCTATTA CTCTCATCGC TACCTCCCTG ACAAGCGCCT ATAGCACTCG AATAATTCTT 
GATAGATAAT GAGAGTAGCG ATGGAGGGAC TGTTCGCGGA TATCGTGAGC TTATTAAGAA 
                                                                  
     13630      13640      13650      13660      13670      13680 
CTCACCCTAA CAGGTCAACC TCGCTTCCCC ACCCTTACTA ACATTAACGA AAATAACCCC 
GAGTGGGATT GTCCAGTTGG AGCGAAGGGG TGGGAATGAT TGTAATTGCT TTTATTGGGG 
                                                                  
     13690      13700      13710      13720      13730      13740 
ACCCTACTAA ACCCCATTAA ACGCCTGGCA GCCGGAAGCC TATTCGCAGG ATTTCTCATT   Back to Top
TGGGATGATT TGGGGTAATT TGCGGACCGT CGGCCTTCGG ATAAGCGTCC TAAAGAGTAA 
                                                                  
     13750      13760      13770      13780      13790      13800 
ACTAACAACA TTTCCCCCGC ATCCCCCTTC CAAACAACAA TCCCCCTCTA CCTAAAACTC 
TGATTGTTGT AAAGGGGGCG TAGGGGGAAG GTTTGTTGTT AGGGGGAGAT GGATTTTGAG 
                                                                  
     13810      13820      13830      13840      13850      13860 
ACAGCCCTCG CTGTCACTTT CCTAGGACTT CTAACAGCCC TAGACCTCAA CTACCTAACC 
TGTCGGGAGC GACAGTGAAA GGATCCTGAA GATTGTCGGG ATCTGGAGTT GATGGATTGG 
                                                                  
     13870      13880      13890      13900      13910      13920 
AACAAACTTA AAATAAAATC CCCACTATGC ACATTTTATT TCTCCAACAT ACTCGGATTC 
TTGTTTGAAT TTTATTTTAG GGGTGATACG TGTAAAATAA AGAGGTTGTA TGAGCCTAAG 
                                                                  
     13930      13940      13950      13960      13970      13980 
TACCCTAGCA TCACACACCG CACAATCCCC TATCTAGGCC TTCTTACGAG CCAAAACCTG 
ATGGGATCGT AGTGTGTGGC GTGTTAGGGG ATAGATCCGG AAGAATGCTC GGTTTTGGAC 
                                                                  
     13990      14000      14010      14020      14030      14040 
CCCCTACTCC TCCTAGACCT AACCTGACTA GAAAAGCTAT TACCTAAAAC AATTTCACAG 
GGGGATGAGG AGGATCTGGA TTGGACTGAT CTTTTCGATA ATGGATTTTG TTAAAGTGTC 
                                                                  
     14050      14060      14070      14080      14090      14100 
CACCAAATCT CCACCTCCAT CATCACCTCA ACCCAAAAAG GCATAATTAA ACTTTACTTC 
GTGGTTTAGA GGTGGAGGTA GTAGTGGAGT TGGGTTTTTC CGTATTAATT TGAAATGAAG 
                                                                  
     14110      14120      14130      14140      14150      14160 
CTCTCTTTCT TCTTCCCACT CATCCTAACC CTACTCCTAA TCACATAACC TATTCCCCCG 
GAGAGAAAGA AGAAGGGTGA GTAGGATTGG GATGAGGATT AGTGTATTGG ATAAGGGGGC 
                                                                  
     14170      14180      14190      14200      14210      14220 
AGCAATCTCA ATTACAATAT ATACACCAAC AAACAATGTT CAACCAGTAA CTACTACTAA 
TCGTTAGAGT TAATGTTATA TATGTGGTTG TTTGTTACAA GTTGGTCATT GATGATGATT 
                                                                  
     14230      14240      14250      14260      14270      14280 
TCAACGCCCA TAATCATACA AAGCCCCCGC ACCAATAGGA TCCTCCCGAA TCAACCCTGA 
AGTTGCGGGT ATTAGTATGT TTCGGGGGCG TGGTTATCCT AGGAGGGCTT AGTTGGGACT 
                                                                  
     14290      14300      14310      14320      14330      14340 
CCCCTCTCCT TCATAAATTA TTCAGCTTCC TACACTATTA AAGTTTACCA CAACCACCAC 
GGGGAGAGGA AGTATTTAAT AAGTCGAAGG ATGTGATAAT TTCAAATGGT GTTGGTGGTG 
                                                                  
     14350      14360      14370      14380      14390      14400 
CCCATCATAC TCTTTCACCC ACAGCACCAA TCCTACCTCC ATCGCTAACC CCACTAAAAC   Back to Top
GGGTAGTATG AGAAAGTGGG TGTCGTGGTT AGGATGGAGG TAGCGATTGG GGTGATTTTG 
                                                                  
     14410      14420      14430      14440      14450      14460 
ACTCACCAAG ACCTCAACCC CTGACCCCCA TGCCTCAGGA TACTCCTCAA TAGCCATCGC 
TGAGTGGTTC TGGAGTTGGG GACTGGGGGT ACGGAGTCCT ATGAGGAGTT ATCGGTAGCG 
                                                                  
     14470      14480      14490      14500      14510      14520 
TGTAGTATAT CCAAAGACAA CCATCATTCC CCCTAAATAA ATTAAAAAAA CTATTAAACC 
ACATCATATA GGTTTCTGTT GGTAGTAAGG GGGATTTATT TAATTTTTTT GATAATTTGG 
                                                                  
     14530      14540      14550      14560      14570      14580 
CATATAACCT CCCCCAAAAT TCAGAATAAT AACACACCCG ACCACACCGC TAACAATCAA 
GTATATTGGA GGGGGTTTTA AGTCTTATTA TTGTGTGGGC TGGTGTGGCG ATTGTTAGTT 
                                                                  
     14590      14600      14610      14620      14630      14640 
TACTAAACCC CCATAAATAG GAGAAGGCTT AGAAGAAAAC CCCACAAACC CCATTACTAA 
ATGATTTGGG GGTATTTATC CTCTTCCGAA TCTTCTTTTG GGGTGTTTGG GGTAATGATT 
                                                                  
     14650      14660      14670      14680      14690      14700 
ACCCACACTC AACAGAAACA AAGCATACAT CATTATTCTC GCACGGACTA CAACCACGAC 
TGGGTGTGAG TTGTCTTTGT TTCGTATGTA GTAATAAGAG CGTGCCTGAT GTTGGTGCTG 
                                                                  
     14710      14720      14730      14740      14750      14760 
CAATGATATG AAAAACCATC GTTGTATTTC AACTACAAGA ACACCAATGA CCCCAATACG 
GTTACTATAC TTTTTGGTAG CAACATAAAG TTGATGTTCT TGTGGTTACT GGGGTTATGC 
                                                                  
     14770      14780      14790      14800      14810      14820 
CAAAACTAAC CCCCTAATAA AATTAATTAA CCACTCATTC ATCGACCTCC CCACCCCATC    Back to Top
GTTTTGATTG GGGGATTATT TTAATTAATT GGTGAGTAAG TAGCTGGAGG GGTGGGGTAG 
                                                                  
     14830      14840      14850      14860      14870      14880 
CAACATCTCC GCATGATGAA ACTTCGGCTC ACTCCTTGGC GCCTGCCTGA TCCTCCAAAT 
GTTGTAGAGG CGTACTACTT TGAAGCCGAG TGAGGAACCG CGGACGGACT AGGAGGTTTA 
                                                                  
     14890      14900      14910      14920      14930      14940 
CACCACAGGA CTATTCCTAG CCATGCACTA CTCACCAGAC GCCTCAACCG CCTTTTCATC 
GTGGTGTCCT GATAAGGATC GGTACGTGAT GAGTGGTCTG CGGAGTTGGC GGAAAAGTAG 
                                                                  
     14950      14960      14970      14980      14990      15000 
AATCGCCCAC ATCACTCGAG ACGTAAATTA TGGCTGAATC ATCCGCTACC TTCACGCCAA 
TTAGCGGGTG TAGTGAGCTC TGCATTTAAT ACCGACTTAG TAGGCGATGG AAGTGCGGTT 
                                                                  
     15010      15020      15030      15040      15050      15060 
TGGCGCCTCA ATATTCTTTA TCTGCCTCTT CCTACACATC GGGCGAGGCC TATATTACGG 
ACCGCGGAGT TATAAGAAAT AGACGGAGAA GGATGTGTAG CCCGCTCCGG ATATAATGCC 
                                                                  
     15070      15080      15090      15100      15110      15120 
ATCATTTCTC TACTCAGAAA CCTGAAACAT CGGCATTATC CTCCTGCTTG CAACTATAGC 
TAGTAAAGAG ATGAGTCTTT GGACTTTGTA GCCGTAATAG GAGGACGAAC GTTGATATCG 
                                                                  
     15130      15140      15150      15160      15170      15180 
AACAGCCTTC ATAGGCTATG TCCTCCCGTG AGGCCAAATA TCATTCTGAG GGGCCACAGT 
TTGTCGGAAG TATCCGATAC AGGAGGGCAC TCCGGTTTAT AGTAAGACTC CCCGGTGTCA 
                                                                  
     15190      15200      15210      15220      15230      15240 
AATTACAAAC TTACTATCCG CCATCCCATA CATTGGGACA GACCTAGTTC AATGAATCTG 
TTAATGTTTG AATGATAGGC GGTAGGGTAT GTAACCCTGT CTGGATCAAG TTACTTAGAC 
                                                                  
     15250      15260      15270      15280      15290      15300 
AGGAGGCTAC TCAGTAGACA GTCCCACCCT CACACGATTC TTTACCTTTC ACTTCATCTT 
TCCTCCGATG AGTCATCTGT CAGGGTGGGA GTGTGCTAAG AAATGGAAAG TGAAGTAGAA 
                                                                  
     15310      15320      15330      15340      15350      15360 
GCCCTTCATT ATTGCAGCCC TAGCAACACT CCACCTCCTA TTCTTGCACG AAACGGGATC    Back to Top
CGGGAAGTAA TAACGTCGGG ATCGTTGTGA GGTGGAGGAT AAGAACGTGC TTTGCCCTAG 
                                                                  
     15370      15380      15390      15400      15410      15420 
AAACAACCCC CTAGGAATCA CCTCCCATTC CGATAAAATC ACCTTCCACC CTTACTACAC 
TTTGTTGGGG GATCCTTAGT GGAGGGTAAG GCTATTTTAG TGGAAGGTGG GAATGATGTG 
                                                                  
     15430      15440      15450      15460      15470      15480 
AATCAAAGAC GCCCTCGGCT TACTTCTCTT CCTTCTCTCC TTAATGACAT TAACACTATT 
TTAGTTTCTG CGGGAGCCGA ATGAAGAGAA GGAAGAGAGG AATTACTGTA ATTGTGATAA 
                                                                  
     15490      15500      15510      15520      15530      15540 
CTCACCAGAC CTCCTAGGCG ACCCAGACAA TTATACCCTA GCCAACCCCT TAAACACCCC 
GAGTGGTCTG GAGGATCCGC TGGGTCTGTT AATATGGGAT CGGTTGGGGA ATTTGTGGGG 
                                                                  
     15550      15560      15570      15580      15590      15600 
TCCCCACATC AAGCCCGAAT GATATTTCCT ATTCGCCTAC ACAATTCTCC GATCCGTCCC 
AGGGGTGTAG TTCGGGCTTA CTATAAAGGA TAAGCGGATG TGTTAAGAGG CTAGGCAGGG 
                                                                  
     15610      15620      15630      15640      15650      15660 
TAACAAACTA GGAGGCGTCC TTGCCCTATT ACTATCCATC CTCATCCTAG CAATAATCCC 
ATTGTTTGAT CCTCCGCAGG AACGGGATAA TGATAGGTAG GAGTAGGATC GTTATTAGGG 
                                                                  
     15670      15680      15690      15700      15710      15720 
CATCCTCCAT ATATCCAAAC AACAAAGCAT AATATTTCGC CCACTAAGCC AATCACTTTA 
GTAGGAGGTA TATAGGTTTG TTGTTTCGTA TTATAAAGCG GGTGATTCGG TTAGTGAAAT 
                                                                  
     15730      15740      15750      15760      15770      15780 
TTGACTCCTA GCCGCAGACC TCCTCATTCT AACCTGAATC GGAGGACAAC CAGTAAGCTA 
AACTGAGGAT CGGCGTCTGG AGGAGTAAGA TTGGACTTAG CCTCCTGTTG GTCATTCGAT 
                                                                  
     15790      15800      15810      15820      15830      15840 
CCCTTTTACC ATCATTGGAC AAGTAGCATC CGTACTATAC TTCACAACAA TCCTAATCCT 
GGGAAAATGG TAGTAACCTG TTCATCGTAG GCATGATATG AAGTGTTGTT AGGATTAGGA 
                                                                  
     15850      15860      15870      15880      15890      15900 
AATACCAACT ATCTCCCTAA TTGAAAACAA AATACTCAAA TGGGCCTGTC CTTGTAGTAT 
TTATGGTTGA TAGAGGGATT AACTTTTGTT TTATGAGTTT ACCCGGACAG GAACATCATA 
                                                                  
     15910      15920      15930      15940      15950      15960 
AAACTAATAC ACCAGTCTTG TAAACCGGAG ATGAAAACCT TTTTCCAAGG ACAAATCAGA 
TTTGATTATG TGGTCAGAAC ATTTGGCCTC TACTTTTGGA AAAAGGTTCC TGTTTAGTCT 
                                                                  
     15970      15980      15990      16000      16010      16020 
GAAAAAGTCT TTAACTCCAC CATTAGCACC CAAAGCTAAG ATTCTAATTT AAACTATTCT 
CTTTTTCAGA AATTGAGGTG GTAATCGTGG GTTTCGATTC TAAGATTAAA TTTGATAAGA 
                                                                  
     16030      16040      16050      16060      16070      16080 
CTGTTCTTTC ATGGGGAAGC AGATTTGGGT ACCACCCAAG TATTGACTCA CCCATCAACA 
GACAAGAAAG TACCCCTTCG TCTAAACCCA TGGTGGGTTC ATAACTGAGT GGGTAGTTGT 
                                                                  
     16090      16100      16110      16120      16130      16140 
ACCGCTATGT ATTTCGTACA TTACTGCCAG CCACCATGAA TATTGTACGG TACCATAAAT 
TGGCGATACA TAAAGCATGT AATGACGGTC GGTGGTACTT ATAACATGCC ATGGTATTTA 
                                                                  
     16150      16160      16170      16180      16190      16200 
ACTTGACCAC CTGTAGTACA TAAAAACCCA ATCCACATCA AAACCCCCTC CCCATGCTTA 
TGAACTGGTG GACATCATGT ATTTTTGGGT TAGGTGTAGT TTTGGGGGAG GGGTACGAAT 
                                                                  
     16210      16220      16230      16240      16250      16260 
CAAGCAAGTA CAGCAATCAA CCCTCAACTA TCACACATCA ACTGCAACTC CAAAGCCACC 
GTTCGTTCAT GTCGTTAGTT GGGAGTTGAT AGTGTGTAGT TGACGTTGAG GTTTCGGTGG 
                                                                  
     16270      16280      16290      16300      16310      16320 
CCTCACCCAC TAGGATACCA ACAAACCTAC CCACCCTTAA CAGTACATAG TACATAAAGC 
GGAGTGGGTG ATCCTATGGT TGTTTGGATG GGTGGGAATT GTCATGTATC ATGTATTTCG 
                                                                  
     16330      16340      16350      16360      16370      16380 
CATTTACCGT ACATAGCACA TTACAGTCAA ATCCCTTCTC GTCCCCATGG ATGACCCCCC 
GTAAATGGCA TGTATCGTGT AATGTCAGTT TAGGGAAGAG CAGGGGTACC TACTGGGGGG 
                                                                  
     16390      16400      16410      16420      16430      16440 
TCAGATAGGG GTCCCTTGAC CACCATCCTC CGTGAAATCA ATATCCCGCA CAAGAGTGCT 
AGTCTATCCC CAGGGAACTG GTGGTAGGAG GCACTTTAGT TATAGGGCGT GTTCTCACGA 
                                                                  
     16450      16460      16470      16480      16490      16500 
ACTCTCCTCG CTCCGGGCCC ATAACACTTG GGGGTAGCTA AAGTGAACTG TATCCGACAT 
TGAGAGGAGC GAGGCCCGGG TATTGTGAAC CCCCATCGAT TTCACTTGAC ATAGGCTGTA 
                                                                  
     16510      16520      16530      16540      16550      16560 
CTGGTTCCTA CTTCAGGGTC ATAAAGCCTA AATAGCCCAC ACGTTCCCCT TAAATAAGAC 
GACCAAGGAT GAAGTCCCAG TATTTCGGAT TTATCGGGTG TGCAAGGGGA ATTTATTCTG 
                                                                  
    16569                                                         
ATCACGATG                                                         
TAGTGCTAC

LOCUS       NC_012920      16569 bp    DNA     circular   PRI 8-JUL-2009
DEFINITION  Homo sapiens mitochondrion, complete genome.
ACCESSION   NC_012920 AC_000021
VERSION     NC_012920.1  GI:251831106
PROJECT     GenomeProject:30353
KEYWORDS    .
SOURCE      mitochondrion Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
FEATURES             Location/Qualifiers
     source          1..16569
                     /organism="Homo sapiens"
                     /organelle="mitochondrion"

                     /mol_type="genomic DNA"
                     /isolation_source="caucasian"
                     /db_xref="taxon:9606"
                     /tissue_type="placenta"
                     /country="United Kingdom: Great Britain"

                     /note="this is the rCRS"
     D-loop          complement(join(16024..16569,1..576))
     gene            577..647
                     /gene="TRNF"
                     /nomenclature="Official Symbol: MT-TF | Name:
                     mitochondrially encoded tRNA phenylalanine | Provided by:
                     HGNC:7481"
                     /db_xref="GeneID:4558"
                     /db_xref="HGNC:7481"

     tRNA            577..647
                     /gene="TRNF"
                     /product="tRNA-Phe"
                     /note="NAR: 1455"
                     /anticodon=(pos:611..613,aa:Phe)
                     /codon_recognized="UUC"
                     /db_xref="GeneID:4558"

                     /db_xref="HGNC:7481"
     gene            648..1601
                     /gene="RNR1"
                     /synonym="MTRNR1"
                     /nomenclature="Official Symbol: MT-RNR1 | Name:
                     mitochondrially encoded 12S RNA | Provided by: HGNC:7470"
                     /db_xref="GeneID:4549"

                     /db_xref="HGNC:7470"
     rRNA            648..1601
                     /gene="RNR1"
                     /product="s-rRNA"
                     /note="12S rRNA; 12S ribosomal RNA"
                     /db_xref="GeneID:4549"

                     /db_xref="HGNC:7470"
     gene            1602..1670
                     /gene="TRNV"
                     /synonym="MTTV"
                     /nomenclature="Official Symbol: MT-TV | Name:
                     mitochondrially encoded tRNA valine | Provided by:
                     HGNC:7500"
                     /db_xref="GeneID:4577"

                     /db_xref="HGNC:7500"
     tRNA            1602..1670
                     /gene="TRNV"
                     /product="tRNA-Val"
                     /note="NAR: 2053"
                     /anticodon=(pos:1633..1635,aa:Val)
                     /codon_recognized="GUA"

                     /db_xref="GeneID:4577"
                     /db_xref="HGNC:7500"
     gene            1671..3229
                     /gene="RNR2"
                     /synonym="MTRNR2"
                     /nomenclature="Official Symbol: MT-RNR2 | Name:
                     mitochondrially encoded 16S RNA | Provided by: HGNC:7471"

                     /db_xref="GeneID:4550"
                     /db_xref="HGNC:7471"
     rRNA            1671..3229
                     /gene="RNR2"
                     /product="l-rRNA"
                     /note="16S ribosomal RNA; 16S rRNA"

                     /db_xref="GeneID:4550"
                     /db_xref="HGNC:7471"
     misc_feature    3107
                     /note="preserves historical genome annotation numbering"
     gene            3230..3304
                     /gene="TRNL1"
                     /synonym="MTTL1"

                     /nomenclature="Official Symbol: MT-TL1 | Name:
                     mitochondrially encoded tRNA leucine 1 (UUA/G) | Provided
                     by: HGNC:7490"
                     /db_xref="GeneID:4567"
                     /db_xref="HGNC:7490"
     tRNA            3230..3304
                     /gene="TRNL1"
                     /product="tRNA-Leu"

                     /note="NAR: 1054"
                     /anticodon=(pos:3265..3267,aa:Leu)
                     /codon_recognized="UUR"
                     /db_xref="GeneID:4567"
                     /db_xref="HGNC:7490"
     gene            3307..4262
                     /gene="ND1"

                     /synonym="MTND1"
                     /nomenclature="Official Symbol: MT-ND1 | Name:
                     mitochondrially encoded NADH dehydrogenase 1 | Provided
                     by: HGNC:7455"
                     /db_xref="GeneID:4535"
                     /db_xref="HGNC:7455"
     CDS             3307..4262
                     /gene="ND1"

                     /note="NADH dehydrogenase, subunit 1 (complex I); TAA stop
                     codon is completed by the addition of 3' A residues to the
                     mRNA"
                     /codon_start=1
                     /transl_except=(pos:4261..4262,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 1"
                     /protein_id="AP_000639.1"
                     /db_xref="GI:58615663"
                     /db_xref="GeneID:4535"

                     /db_xref="HGNC:7455"
                     /translation="MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYG
                     LLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGL
                     LFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSF
                     NLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAG
                     PFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTA
                     YPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT"
     gene            4263..4331
                     /gene="TRNI"
                     /synonym="MTTI"
                     /nomenclature="Official Symbol: MT-TI | Name:
                     mitochondrially encoded tRNA isoleucine | Provided by:
                     HGNC:7488"

                     /db_xref="GeneID:4565"
                     /db_xref="HGNC:7488"
     tRNA            4263..4331
                     /gene="TRNI"
                     /product="tRNA-Ile"
                     /note="NAR: 0997"

                     /anticodon=(pos:4292..4294,aa:Ile)
                     /codon_recognized="AUC"
                     /db_xref="GeneID:4565"
                     /db_xref="HGNC:7488"
     gene            complement(4329..4400)
                     /gene="TRNQ"
                     /synonym="MTTQ"

                     /nomenclature="Official Symbol: MT-TQ | Name:
                     mitochondrially encoded tRNA glutamine | Provided by:
                     HGNC:7495"
                     /db_xref="GeneID:4572"
                     /db_xref="HGNC:7495"
     tRNA            complement(4329..4400)
                     /gene="TRNQ"
                     /product="tRNA-Gln"

                     /note="NAR: 0597"
                     /anticodon=(pos:complement(4365..4367),aa:Gln)
                     /codon_recognized="CAA"
                     /db_xref="GeneID:4572"
                     /db_xref="HGNC:7495"
     gene            4402..4469
                     /gene="TRNM"

                     /synonym="MTTM"
                     /nomenclature="Official Symbol: MT-TM | Name:
                     mitochondrially encoded tRNA methionine | Provided by:
                     HGNC:7492"
                     /db_xref="GeneID:4569"
                     /db_xref="HGNC:7492"
     tRNA            4402..4469
                     /gene="TRNM"

                     /product="tRNA-Met"
                     /note="NAR: 1297"
                     /anticodon=(pos:4432..4434,aa:Met)
                     /codon_recognized="AUG"
                     /db_xref="GeneID:4569"
                     /db_xref="HGNC:7492"

     gene            4470..5511
                     /gene="ND2"
                     /synonym="MTND2"
                     /nomenclature="Official Symbol: MT-ND2 | Name:
                     mitochondrially encoded NADH dehydrogenase 2 | Provided
                     by: HGNC:7456"
                     /db_xref="GeneID:4536"
                     /db_xref="HGNC:7456"

     CDS             4470..5511
                     /gene="ND2"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:5511,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 2"
                     /protein_id="AP_000640.1"
                     /db_xref="GI:58615664"

                     /db_xref="GeneID:4536"
                     /db_xref="HGNC:7456"
                     /translation="MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVL
                     TKKMNPRSTEAAIKYFLTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAM
                     AMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSIL
                     SIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLL
                     LNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSL
                     IIPTIMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTT
                     LLLPISPFMLMIL"
     gene            5512..5579
                     /gene="TRNW"
                     /synonym="MTTW"

                     /nomenclature="Official Symbol: MT-TW | Name:
                     mitochondrially encoded tRNA tryptophan | Provided by:
                     HGNC:7501"
                     /db_xref="GeneID:4578"
                     /db_xref="HGNC:7501"
     tRNA            5512..5579
                     /gene="TRNW"
                     /product="tRNA-Trp"

                     /note="NAR: 1897"
                     /anticodon=(pos:5544..5546,aa:Trp)
                     /codon_recognized="UGA"
                     /db_xref="GeneID:4578"
                     /db_xref="HGNC:7501"
     gene            complement(5587..5655)
                     /gene="TRNA"

                     /synonym="MTTA"
                     /nomenclature="Official Symbol: MT-TA | Name:
                     mitochondrially encoded tRNA alanine | Provided by:
                     HGNC:7475"
                     /db_xref="GeneID:4553"
                     /db_xref="HGNC:7475"
     tRNA            complement(5587..5655)
                     /gene="TRNA"

                     /product="tRNA-Ala"
                     /note="NAR: 0097"
                     /anticodon=(pos:complement(5623..5625),aa:Ala)
                     /codon_recognized="GCA"
                     /db_xref="GeneID:4553"
                     /db_xref="HGNC:7475"

     gene            complement(5657..5729)
                     /gene="TRNN"
                     /synonym="MTTN"
                     /nomenclature="Official Symbol: MT-TN | Name:
                     mitochondrially encoded tRNA asparagine | Provided by:
                     HGNC:7493"
                     /db_xref="GeneID:4570"
                     /db_xref="HGNC:7493"

     tRNA            complement(5657..5729)
                     /gene="TRNN"
                     /product="tRNA-Asn"
                     /note="NAR: 0297"
                     /anticodon=(pos:complement(5694..5696),aa:Asn)
                     /codon_recognized="AAC"
                     /db_xref="GeneID:4570"

                     /db_xref="HGNC:7493"
     gene            complement(5761..5826)
                     /gene="TRNC"
                     /synonym="MTTC"
                     /nomenclature="Official Symbol: MT-TC | Name:
                     mitochondrially encoded tRNA cysteine | Provided by:
                     HGNC:7477"
                     /db_xref="GeneID:4511"

                     /db_xref="HGNC:7477"
     tRNA            complement(5761..5826)
                     /gene="TRNC"
                     /product="tRNA-Cys"
                     /note="NAR: 0497"
                     /anticodon=(pos:complement(5796..5798),aa:Cys)
                     /codon_recognized="UGC"

                     /db_xref="GeneID:4511"
                     /db_xref="HGNC:7477"
     gene            complement(5826..5891)
                     /gene="TRNY"
                     /synonym="MTTY"
                     /nomenclature="Official Symbol: MT-TY | Name:
                     mitochondrially encoded tRNA tyrosine | Provided by:
                     HGNC:7502"

                     /db_xref="GeneID:4579"
                     /db_xref="HGNC:7502"
     tRNA            complement(5826..5891)
                     /gene="TRNY"
                     /product="tRNA-Tyr"
                     /note="NAR: 1997"

                     /anticodon=(pos:complement(5860..5862),aa:Tyr)
                     /codon_recognized="UAC"
                     /db_xref="GeneID:4579"
                     /db_xref="HGNC:7502"
     gene            5904..7445
                     /gene="COX1"
                     /synonym="MTCO1, COI"

                     /nomenclature="Official Symbol: MT-COI | Name:
                     mitochondrially encoded cytochrome c oxidase I | Provided
                     by: HGNC:7419"
                     /db_xref="GeneID:4512"
                     /db_xref="HGNC:7419"
     CDS             5904..7445
                     /gene="COX1"
                     /note="cytochrome c oxidase I"

                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="AP_000641.1"
                     /db_xref="GI:58615665"
                     /db_xref="GeneID:4512"
                     /db_xref="HGNC:7419"

                     /translation="MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQP
                     GNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSF
                     WLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG
                     AINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTT
                     FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWA
                     MMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKW
                     SAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGG
                     FIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTW
                     NILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEP
                     VYMKS"
     gene            complement(7446..7514)
                     /gene="TRNS1"
                     /synonym="MTTS1"
                     /nomenclature="Official Symbol: MT-TS1 | Name:
                     mitochondrially encoded tRNA serine 1 (UCN) | Provided by:
                     HGNC:7497"
                     /db_xref="GeneID:4574"

                     /db_xref="HGNC:7497"
     tRNA            complement(7446..7514)
                     /gene="TRNS1"
                     /product="tRNA-Ser"
                     /note="NAR: 1697"
                     /anticodon=(pos:complement(7482..7484),aa:Ser)
                     /codon_recognized="UCN"

                     /db_xref="GeneID:4574"
                     /db_xref="HGNC:7497"
     gene            7518..7585
                     /gene="TRND"
                     /synonym="MTTD"
                     /nomenclature="Official Symbol: MT-TD | Name:
                     mitochondrially encoded tRNA aspartic acid | Provided by:
                     HGNC:7478"

                     /db_xref="GeneID:4555"
                     /db_xref="HGNC:7478"
     tRNA            7518..7585
                     /gene="TRND"
                     /product="tRNA-Asp"
                     /note="NAR: 0397"

                     /anticodon=(pos:7548..7550,aa:Asp)
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4555"
                     /db_xref="HGNC:7478"
     gene            7586..8269
                     /gene="COX2"
                     /synonym="MTCO2, COII"

                     /nomenclature="Official Symbol: MT-CO2 | Name:
                     mitochondrially encoded cytochrome c oxidase II | Provided
                     by: HGNC:7421"
                     /db_xref="GeneID:4513"
                     /db_xref="HGNC:7421"
     CDS             7586..8269
                     /gene="COX2"
                     /note="cytochrome c oxidase II"

                     /codon_start=1
                     /transl_table=2
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="AP_000642.1"
                     /db_xref="GI:58615666"
                     /db_xref="GeneID:4513"
                     /db_xref="HGNC:7421"

                     /translation="MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFL
                     TLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGH
                     QWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVL
                     HSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKI
                     FEMGPVFTL"
     gene            8295..8364
                     /gene="TRNK"
                     /synonym="MTTK"
                     /nomenclature="Official Symbol: MT-TK | Name:
                     mitochondrially encoded tRNA lysine | Provided by:
                     HGNC:7489"
                     /db_xref="GeneID:4566"

                     /db_xref="HGNC:7489"
     tRNA            8295..8364
                     /gene="TRNK"
                     /product="tRNA-Lys"
                     /note="NAR: 1197"
                     /anticodon=(pos:8323..8325,aa:Lys)
                     /codon_recognized="AAA"

                     /db_xref="GeneID:4566"
                     /db_xref="HGNC:7489"
     gene            8366..8572
                     /gene="ATP8"
                     /synonym="MTATP8, ATPase8"
                     /nomenclature="Official Symbol: MT-ATP8 | Name:
                     mitochondrially encoded ATP synthase 8 | Provided by:
                     HGNC:7415"

                     /db_xref="GeneID:4509"
                     /db_xref="HGNC:7415"
     CDS             8366..8572
                     /gene="ATP8"
                     /note="ATP synthase 8; ATPase subunit 8"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 8"

                     /protein_id="AP_000643.1"
                     /db_xref="GI:58615667"
                     /db_xref="GeneID:4509"
                     /db_xref="HGNC:7415"
                     /translation="MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKM
                     KNYNKPWEPKWTKICSLHSLPPQS"

     gene            8527..9207
                     /gene="ATP6"
                     /synonym="MTATP6, ATPase6"
                     /nomenclature="Official Symbol: MT-ATP6 | Name:
                     mitochondrially encoded ATP synthase 6 | Provided by:
                     HGNC:7414"
                     /db_xref="GeneID:4508"
                     /db_xref="HGNC:7414"

     CDS             8527..9207
                     /gene="ATP6"
                     /note="ATP synthase 6; ATPase subunit 6"
                     /codon_start=1
                     /transl_table=2
                     /product="ATP synthase F0 subunit 6"
                     /protein_id="AP_000644.1"
                     /db_xref="GI:58615668"

                     /db_xref="GeneID:4508"
                     /db_xref="HGNC:7414"
                     /translation="MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLIT
                     TQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNL
                     AMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRL
                     TANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLV
                     SLYLHDNT"
     gene            9207..9990
                     /gene="COX3"
                     /synonym="MTCO3, COIII"

                     /nomenclature="Official Symbol: MT-CO3 | Name:
                     mitochondrially encoded cytochrome c oxidase III |
                     Provided by: HGNC:7422"
                     /db_xref="GeneID:4514"
                     /db_xref="HGNC:7422"
     CDS             9207..9990
                     /gene="COX3"
                     /note="cytochrome c oxidase III; TAA stop codon is
                     completed by the addition of 3' A residues to the mRNA"

                     /codon_start=1
                     /transl_except=(pos:9990,aa:TERM)
                     /transl_table=2
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="AP_000645.2"
                     /db_xref="GI:193885684"
                     /db_xref="GeneID:4514"
                     /db_xref="HGNC:7422"

                     /translation="MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLM
                     LGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFY
                     HSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI
                     QALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTIC
                     FIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
     gene            9991..10058
                     /gene="TRNG"
                     /synonym="MTTG"
                     /nomenclature="Official Symbol: MT-TG | Name:
                     mitochondrially encoded tRNA glycine | Provided by:
                     HGNC:7486"
                     /db_xref="GeneID:4563"

                     /db_xref="HGNC:7486"
     tRNA            9991..10058
                     /gene="TRNG"
                     /product="tRNA-Gly"
                     /note="NAR: 0797"
                     /anticodon=(pos:10021..10023,aa:Gly)
                     /codon_recognized="GGA"

                     /db_xref="GeneID:4563"
                     /db_xref="HGNC:7486"
     gene            10059..10404
                     /gene="ND3"
                     /synonym="MTND3"
                     /nomenclature="Official Symbol: MT-ND3 | Name:
                     mitochondrially encoded NADH dehydrogenase 3 | Provided
                     by: HGNC:7458"

                     /db_xref="GeneID:4537"
                     /db_xref="HGNC:7458"
     CDS             10059..10404
                     /gene="ND3"
                     /note="NADH dehydrogenase, subunit 3 (complex I); TAA stop
                     codon is completed by the addition of 3' A residues to the
                     mRNA"
                     /codon_start=1
                     /transl_except=(pos:10404,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 3"

                     /protein_id="AP_000646.1"
                     /db_xref="GI:58615670"
                     /db_xref="GeneID:4537"
                     /db_xref="HGNC:7458"
                     /translation="MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPM
                     SPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSL
                     AYEWLQKGLDWTE"

     gene            10405..10469
                     /gene="TRNR"
                     /synonym="MTTR"
                     /nomenclature="Official Symbol: MT-TR | Name:
                     mitochondrially encoded tRNA arginine | Provided by:
                     HGNC:7496"
                     /db_xref="GeneID:4573"
                     /db_xref="HGNC:7496"

     tRNA            10405..10469
                     /gene="TRNR"
                     /product="tRNA-Arg"
                     /note="NAR: 0197"
                     /anticodon=(pos:10435..10437,aa:Arg)
                     /codon_recognized="CGA"
                     /db_xref="GeneID:4573"

                     /db_xref="HGNC:7496"
     gene            10470..10766
                     /gene="ND4L"
                     /synonym="MTND4L"
                     /nomenclature="Official Symbol: MT-ND4L | Name:
                     mitochondrially encoded NADH 4L | Provided by: HGNC:7460"
                     /db_xref="GeneID:4539"

                     /db_xref="HGNC:7460"
     CDS             10470..10766
                     /gene="ND4L"
                     /note="NADH dehydrogenase, subunit 4L (complex I)"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4L"
                     /protein_id="AP_000647.1"

                     /db_xref="GI:58615671"
                     /db_xref="GeneID:4539"
                     /db_xref="HGNC:7460"
                     /translation="MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMA
                     TLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC"
     gene            10760..12137
                     /gene="ND4"

                     /synonym="MTND4"
                     /nomenclature="Official Symbol: MT-ND4 | Name:
                     mitochondrially encoded NADH dehydrogenase 4 | Provided
                     by: HGNC:7459"
                     /db_xref="GeneID:4538"
                     /db_xref="HGNC:7459"
     CDS             10760..12137
                     /gene="ND4"

                     /note="NADH dehydrogenase, subunit 4 (complex I); TAA stop
                     codon is completed by the addition of 3' A residues to the
                     mRNA"
                     /codon_start=1
                     /transl_except=(pos:12137,aa:TERM)
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 4"
                     /protein_id="AP_000648.1"
                     /db_xref="GI:58615672"
                     /db_xref="GeneID:4538"

                     /db_xref="HGNC:7459"
                     /translation="MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQ
                     INNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISL
                     QISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPL
                     LIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPK
                     AHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSIC
                     LRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNY
                     ERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNIT
                     LLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLN
                     PDIITGFSS"
     gene            12138..12206
                     /gene="TRNH"
                     /synonym="MTTH"
                     /nomenclature="Official Symbol: MT-TH | Name:
                     mitochondrially encoded tRNA histidine | Provided by:
                     HGNC:7487"

                     /db_xref="GeneID:4564"
                     /db_xref="HGNC:7487"
     tRNA            12138..12206
                     /gene="TRNH"
                     /product="tRNA-His"
                     /note="NAR: 0897"

                     /anticodon=(pos:12168..12170,aa:His)
                     /codon_recognized="CAC"
                     /db_xref="GeneID:4564"
                     /db_xref="HGNC:7487"
     gene            12207..12265
                     /gene="TRNS2"
                     /synonym="MTTS2"

                     /nomenclature="Official Symbol: MT-TS2 | Name:
                     mitochondrially encoded tRNA serine 2 (AGU/C) | Provided
                     by: HGNC:7498"
                     /db_xref="GeneID:4575"
                     /db_xref="HGNC:7498"
     tRNA            12207..12265
                     /gene="TRNS2"
                     /product="tRNA-Ser"

                     /note="NAR: 1656"
                     /anticodon=(pos:12226..12228,aa:Ser)
                     /codon_recognized="AGY"
                     /db_xref="GeneID:4575"
                     /db_xref="HGNC:7498"
     gene            12266..12336
                     /gene="TRNL2"

                     /synonym="MTTL2"
                     /nomenclature="Official Symbol: MT-L2 | Name:
                     mitochondrially encoded tRNA leucine 2 (CUN) | Provided
                     by: HGNC:7491"
                     /db_xref="GeneID:4568"
                     /db_xref="HGNC:7491"
     tRNA            12266..12336
                     /gene="TRNL2"

                     /product="tRNA-Leu"
                     /note="NAR: 1097"
                     /anticodon=(pos:12298..12300,aa:Leu)
                     /codon_recognized="CUN"
                     /db_xref="GeneID:4568"
                     /db_xref="HGNC:7491"

     gene            12337..14148
                     /gene="ND5"
                     /synonym="MTND5"
                     /nomenclature="Official Symbol: MTND5 | Name:
                     mitochondrially encoded NADH dehydrogenase 5 | Provided
                     by: HGNC:7461"
                     /db_xref="GeneID:4540"
                     /db_xref="HGNC:7461"

     CDS             12337..14148
                     /gene="ND5"
                     /note="NADH dehydrogenase, subunit 5 (complex I)"
                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 5"
                     /protein_id="AP_000649.1"
                     /db_xref="GI:58615673"

                     /db_xref="GeneID:4540"
                     /db_xref="HGNC:7461"
                     /translation="MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTF
                     IISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIME
                     FSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYA
                     RADANTAAIQAILYNRIGDIGFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLL
                     AAAGKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTL
                     TLCLGAITTLFAAVCALTQNDIKKIVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAF
                     FKAMLFMCSGSIIHNLNNEQDIRKMGGLLKTMPLTSTSLTIGSLALAGMPFLTGFYSK
                     DHIIETANMSYTNAWALSITLIATSLTSAYSTRMILLTLTGQPRFPTLTNINENNPTL
                     LNPIKRLAAGSLFAGFLITNNISPASPFQTTIPLYLKLTALAVTFLGLLTALDLNYLT
                     NKLKMKSPLCTFYFSNMLGFYPSITHRTIPYLGLLTSQNLPLLLLDLTWLEKLLPKTI
                     SQHQISTSIITSTQKGMIKLYFLSFFFPLILTLLLIT"
     gene            complement(14149..14673)
                     /gene="ND6"
                     /synonym="MTND6"

                     /nomenclature="Official Symbol: MT-ND6 | Name:
                     mitochondrially encoded NADH dehydrogenase 6 | Provided
                     by: HGNC:7462"
                     /db_xref="GeneID:4541"
                     /db_xref="HGNC:7462"
     CDS             complement(14149..14673)
                     /gene="ND6"
                     /note="NADH dehydrogenase, subunit 6 (complex I)"

                     /codon_start=1
                     /transl_table=2
                     /product="NADH dehydrogenase subunit 6"
                     /protein_id="AP_000650.1"
                     /db_xref="GI:58615674"
                     /db_xref="GeneID:4541"
                     /db_xref="HGNC:7462"

                     /translation="MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIIL
                     NFGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGL
                     VLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTL
                     FVGVYIVIEIARGN"
     gene            complement(14674..14742)
                     /gene="TRNE"
                     /synonym="MTTE"
                     /nomenclature="Official Symbol: MT-TE | Name:
                     mitochondrially encoded tRNA glutamic acid | Provided by:
                     HGNC:7479"
                     /db_xref="GeneID:4556"

                     /db_xref="HGNC:7479"
     tRNA            complement(14674..14742)
                     /gene="TRNE"
                     /product="tRNA-Glu"
                     /note="NAR: 0697"
                     /anticodon=(pos:complement(14710..14712),aa:Glu)
                     /codon_recognized="GAA"

                     /db_xref="GeneID:4556"
                     /db_xref="HGNC:7479"
     gene            14747..15887
                     /gene="CYTB"
                     /synonym="MTCYB"
                     /nomenclature="Official Symbol: MT-CYB | Name:
                     mitochondrially encoded cytochrome b | Provided by:
                     HGNC:7427"

                     /db_xref="GeneID:4519"
                     /db_xref="HGNC:7427"
     CDS             14747..15887
                     /gene="CYTB"
                     /note="TAA stop codon is completed by the addition of 3' A
                     residues to the mRNA"
                     /codon_start=1
                     /transl_except=(pos:15887,aa:TERM)
                     /transl_table=2
                     /product="cytochrome b"

                     /protein_id="AP_000651.3"
                     /db_xref="GI:193885685"
                     /db_xref="GeneID:4519"
                     /db_xref="HGNC:7427"
                     /translation="MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQ
                     ITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGL
                     YYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDL
                     VQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKI
                     TFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLF
                     AYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLI
                     LTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA"

     gene            15888..15953
                     /gene="TRNT"
                     /synonym="MTTT"
                     /nomenclature="Official Symbol: MT-TT | Name:
                     mitochondrially encoded tRNA threonine | Provided by:
                     HGNC:7499"
                     /db_xref="GeneID:4576"
                     /db_xref="HGNC:7499"

     tRNA            15888..15953
                     /gene="TRNT"
                     /product="tRNA-Thr"
                     /note="NAR: 1797"
                     /anticodon=(pos:15919..15921,aa:Thr)
                     /codon_recognized="ACA"
                     /db_xref="GeneID:4576"

                     /db_xref="HGNC:7499"
     gene            complement(15956..16023)
                     /gene="TRNP"
                     /synonym="MTTP"
                     /nomenclature="Official Symbol: MT-TP | Name:
                     mitochondrially encoded tRNA proline | Provided by:
                     HGNC:7494"
                     /db_xref="GeneID:4571"

                     /db_xref="HGNC:7494"
     tRNA            complement(15956..16023)
                     /gene="TRNP"
                     /product="tRNA-Pro"
                     /note="NAR: 1597"
                     /anticodon=(pos:complement(15990..15992),aa:Pro)
                     /codon_recognized="CCA"

                     /db_xref="GeneID:4571"
                     /db_xref="HGNC:7494"                                                      

Back to Top
Topic revision: r1 - 15 Sep 2015, UnknownUser
This site is powered by FoswikiCopyright © by the contributing authors. All material on this collaboration platform is the property of the contributing authors.
Ideas, requests, problems regarding Foswiki? Send feedback